
  • Product nameAnti-SNT2 antibodySee all SNT2 primary antibodies ...
  • Description
    Rabbit polyclonal to SNT2
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide designed within residues: FPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPGP , corresponding to amino acids 360-409 of Human SNT2 (NP_006644)

  • Positive control
    • DU145 cell lysate



Our Abpromise guarantee covers the use of ab90030 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.


  • RelevanceSNT2 is a substrate for the fibroblast growth factor receptor. It functions in linking FGF receptor stimulation to activators of Ras.
  • Cellular localizationPlasma membrane
  • Database links
  • Alternative names
    • FGFR signalling adaptor SNT2 antibody
    • FGFR substrate 3 antibody
    • Fibroblast growth factor receptor substrate 3 antibody
    • FRS2 beta antibody
    • FRS2B antibody
    • FRS3 antibody
    • FRS3 protein antibody
    • MGC17167 antibody
    • SNT 2 antibody
    • Suc1 associated neurotrophic factor target 2 (FGFR signalling adaptor) antibody
    • Suc1 associated neurotrophic factor target 2 antibody
    see all

Anti-SNT2 antibody images

  • Anti-SNT2 antibody (ab90030) at 1 µg/ml + DUP145 cell lysate at 10 µg

    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 54 kDa

References for Anti-SNT2 antibody (ab90030)

ab90030 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab90030.
Please use the links above to contact us or submit feedback about this product.