Overview
- Product nameAnti-SNT2 antibodySee all SNT2 primary antibodies ...
- DescriptionRabbit polyclonal to SNT2
- Tested applicationsWB more details
- Species reactivityReacts with: Human
Predicted to work with: Mouse, Rat, Cow, Dog - Immunogen
Synthetic peptide designed within residues: FPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRV FNFDFRRPGP, corresponding to amino acids 360-409 of Human SNT2 (NP_006644)
- Positive controlDU145 cell lysate
Properties
- FormLiquid
- Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
- Storage bufferPreservative: None
Constituents: 2% Sucrose, PBS -
Concentration information loading... - PurityImmunogen affinity purified
- Clonality Polyclonal
- IsotypeIgG
- Research Areas
Applications
Our Abpromise guarantee covers the use of ab90030 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Notes |
|---|---|
| WB | WB: Use a concentration of 1 µg/ml. Predicted molecular weight: 54 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T. |
Target
- RelevanceSNT2 is a substrate for the fibroblast growth factor receptor. It functions in linking FGF receptor stimulation to activators of Ras.
- Cellular localizationPlasma membrane
-
Database links
- Entrez Gene: 10817 Human
- Entrez Gene: 10817 Human
- Entrez Gene: 107971 Mouse
- Entrez Gene: 316213 Rat
- Omim: 607744 Human
- SwissProt: O43559 Human
- SwissProt: O43559 Human
- SwissProt: Q91WJ0 Mouse
- SwissProt: Q52RG8 Rat
- Unigene: 194208 Human
- Unigene: 34398 Rat
see all
-
Alternative names
- FGFR signalling adaptor SNT2 antibodyFGFR substrate 3 antibodyFibroblast growth factor receptor substrate 3 antibody
- FRS2 beta antibodyFRS2B antibodyFRS3 antibodyFRS3 protein antibodyMGC17167 antibodySNT 2 antibodySuc1 associated neurotrophic factor target 2 (FGFR signalling adaptor) antibodySuc1 associated neurotrophic factor target 2 antibody
see all
Anti-SNT2 antibody images
-
Western blot - SNT2 antibody (ab90030)Anti-SNT2 antibody (ab90030) at 1 µg/ml + DUP145 cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size : 54 kDa
References for Anti-SNT2 antibody (ab90030)
ab90030 has not yet been referenced specifically in any publications.
