Anti-SOX10 antibody [2E7B5] (ab181466)
Key features and details
- Mouse monoclonal [2E7B5] to SOX10
- Suitable for: WB, Flow Cyt
- Reacts with: Human, Recombinant fragment
- Isotype: IgG1
Overview
-
Product name
Anti-SOX10 antibody [2E7B5]
See all SOX10 primary antibodies -
Description
Mouse monoclonal [2E7B5] to SOX10 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cytmore details -
Species reactivity
Reacts with: Human, Recombinant fragment
Predicted to work with: Mouse, Rat, Chicken, Pig -
Immunogen
Recombinant fragment corresponding to Human SOX10 aa 147-252. (Expressed in E.coli).
Sequence:ESDKRPFIEEAERLRMQHKKDHPDYKYQPRRRKNGKAAQGEAECPGGEAE QGGTAAIQAHYKSAHLDHRHPGEGSPMSDGNPEHPSGQSHGPPTPPTTPK TELQSG
Database link: P56693 -
Positive control
- SOX10 recombinant protein; SOX10 (Amino acid: 147-252)-hIgGFc transfected HEK293 cell lysate; HepG2 cells.
-
General notes
This product was changed from ascites to supernatant. Lot no’s high than GR243375-14 are from Tissue Culture Supernatant
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituent: 99% PBS
Contains 0.5% protein stabilizer. -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from tissue culture supernatant. -
Clonality
Monoclonal -
Clone number
2E7B5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Conjugation kits
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab181466 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 49 kDa.
|
|
Flow Cyt |
1/200 - 1/400.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 49 kDa. |
Flow Cyt
1/200 - 1/400. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Transcription factor that seems to function synergistically with the POU domain protein TST-1/OCT6/SCIP. Could confer cell specificity to the function of other transcription factors in developing and mature glia. -
Tissue specificity
Expressed in fetal brain and in adult brain, heart, small intestine and colon. -
Involvement in disease
Defects in SOX10 are the cause of Waardenburg syndrome type 2E (WS2E) [MIM:611584]. WS2 is a genetically heterogeneous, autosomal dominant disorder characterized by sensorineural deafness, pigmentary disturbances, and absence of dystopia canthorum. The frequency of deafness is higher in WS2 than in WS1.
Defects in SOX10 are a cause of Waardenburg syndrome type 4C (WS4C) [MIM:613266]; also known as Waardenburg-Shah syndrome. WS4C is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease).
Defects in SOX10 are a cause of Yemenite deaf-blind hypopigmentation syndrome (YDBHS) [MIM:601706]. YDBHS consists of cutaneous hypopigmented and hyperpigmented spots and patches, microcornea, coloboma and severe hearing loss. Another case observed in a girl with similar skin symptoms and hearing loss but without microcornea or coloboma is reported as a mild form of this syndrome.
Defects in SOX10 are the cause of peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease (PCWH) [MIM:609136]; also called neurologic variant of Waardenburg-Shah syndrome. PCWH is a rare, complex and more severe neurocristopathy that includes features of 4 distinct syndromes: peripheral demyelinating neuropathy, central dysmyelinating leukodystrophy, Waardenburg syndrome, and Hirschsprung disease. -
Sequence similarities
Contains 1 HMG box DNA-binding domain. -
Cellular localization
Cytoplasm. Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 395573 Chicken
- Entrez Gene: 6663 Human
- Entrez Gene: 20665 Mouse
- Entrez Gene: 414903 Pig
- Entrez Gene: 29361 Rat
- Omim: 602229 Human
- SwissProt: Q9W757 Chicken
- SwissProt: P56693 Human
see all -
Alternative names
- DOM antibody
- DOM antibody
- Dominant megacolon mouse human homolog of antibody
see all
Images
-
Flow cytometric analysis of HepG2 cells labeling SOX10 with ab181466 at 1/200 dilution (green) compared to a negative control (red).
-
All lanes : Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution
Lane 1 : HEK293 cell lysate.
Lane 2 : SOX10 (Amino acids: 147-252)-hIgGFc transfected HEK293 cell lysate.
Predicted band size: 49 kDa -
Anti-SOX10 antibody [2E7B5] (ab181466) at 1/500 dilution + SOX10 recombinant protein
Predicted band size: 49 kDaExpected MWt is 31.7 kDa.
Datasheets and documents
-
Datasheet download
References (2)
ab181466 has been referenced in 2 publications.
- Sun Q et al. FOXD1 promotes dedifferentiation and targeted therapy resistance in melanoma by regulating the expression of connective tissue growth factor. Int J Cancer 149:657-674 (2021). PubMed: 33837564
- Vazquez SE et al. Identification of novel, clinically correlated autoantigens in the monogenic autoimmune syndrome APS1 by proteome-wide PhIP-Seq. Elife 9:N/A (2020). PubMed: 32410729