Anti-SOX17 antibody (ab155402)
Key features and details
- Rabbit polyclonal to SOX17
- Suitable for: WB, IHC-P
- Reacts with: Mouse, Human
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-SOX17 antibody
See all SOX17 primary antibodies -
Description
Rabbit polyclonal to SOX17 -
Host species
Rabbit -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Human
Predicted to work with: Zebrafish -
Immunogen
Synthetic peptide corresponding to Human SOX17 aa 70-120.
Sequence:RPMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVE E
Database link: Q9H6I2 -
Positive control
- Human uterus tissue, Human testis tissue, Mouse embryo brain lysate
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.05% Sodium azide
Constituents: 0.05% BSA, 99% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab155402 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
Use a concentration of 1 - 3 µg/ml. Predicted molecular weight: 44 kDa.
|
|
IHC-P |
Use a concentration of 5 - 10 µg/ml.
|
Notes |
---|
WB
Use a concentration of 1 - 3 µg/ml. Predicted molecular weight: 44 kDa. |
IHC-P
Use a concentration of 5 - 10 µg/ml. |
Target
-
Function
Acts as transcription regulator that binds target promoter DNA and bends the DNA. Binds to the sequences 5'-AACAAT-'3 or 5'-AACAAAG-3'. Modulates transcriptional regulation via WNT3A. Inhibits Wnt signaling. Promotes degradation of activated CTNNB1. Plays a key role in the regulation of embryonic development. Required for normal looping of the embryonic heart tube. Required for normal development of the definitive gut endoderm. Probable transcriptional activator in the premeiotic germ cells. -
Tissue specificity
Expressed in adult heart, lung, spleen, testis, ovary, placenta, fetal lung, and kidney. In normal gastrointestinal tract, it is preferentially expressed in esophagus, stomach and small intestine than in colon and rectum. -
Involvement in disease
Defects in SOX17 are the cause of vesicoureteral reflux type 3 (VUR3) [MIM:613674]. VUR3 is a disease belonging to the group of congenital anomalies of the kidney and urinary tract. It is characterized by the reflux of urine from the bladder into the ureters and sometimes into the kidneys, and is a risk factor for urinary tract infections. Primary disease results from a developmental defect of the ureterovesical junction. In combination with intrarenal reflux, the resulting inflammatory reaction may result in renal injury or scarring, also called reflux nephropathy. Extensive renal scarring impairs renal function and may predispose patients to hypertension, proteinuria, renal insufficiency and end-stage renal disease. -
Sequence similarities
Contains 1 HMG box DNA-binding domain.
Contains 1 Sox C-terminal domain. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 64321 Human
- Entrez Gene: 20671 Mouse
- Entrez Gene: 30544 Zebrafish
- Omim: 610928 Human
- SwissProt: Q9H6I2 Human
- SwissProt: Q61473 Mouse
- Unigene: 98367 Human
- Unigene: 279103 Mouse
-
Alternative names
- FLJ22252 antibody
- SOX17 antibody
- SOX17_HUMAN antibody
see all
Images
-
All lanes : Anti-SOX17 antibody (ab155402) at 1 µg/ml
Lane 1 : Mouse embryo brain lysate
Lane 2 : Mouse embryo brain lysate with immunizing peptide
Secondary
All lanes : Goat anti-rabbit Ig HRP
Developed using the ECL technique.
Predicted band size: 44 kDa -
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human uterus tissue labeling SOX17 using ab155402 at 10 µg/ml.
-
Immunohistochemical analysis of formalin-fixed, paraffin-embedded Human testis tissue labeling SOX17 using ab155402 at 10 µg/ml.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (5)
ab155402 has been referenced in 5 publications.
- Toyoshima KE et al. Regeneration of a bioengineered 3D integumentary organ system from iPS cells. Nat Protoc 14:1323-1338 (2019). PubMed: 30962607
- Jiang X et al. Let-7 microRNA-dependent control of leukotriene signaling regulates the transition of hematopoietic niche in mice. Nat Commun 8:128 (2017). PubMed: 28743859
- Leopardo NP & Vitullo AD Early embryonic development and spatiotemporal localization of mammalian primordial germ cell-associated proteins in the basal rodent Lagostomus maximus. Sci Rep 7:594 (2017). IHC-P ; Other species . PubMed: 28377629
- Li T et al. The spontaneous differentiation and chromosome loss in iPSCs of human trisomy 18 syndrome. Cell Death Dis 8:e3149 (2017). PubMed: 29072700
- Bonney S et al. Diverse Functions of Retinoic Acid in Brain Vascular Development. J Neurosci 36:7786-801 (2016). PubMed: 27445154