Anti-Spir-1 antibody (ab130403)
Key features and details
- Rabbit polyclonal to Spir-1
- Suitable for: ICC/IF, WB, IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Spir-1 antibody -
Description
Rabbit polyclonal to Spir-1 -
Host species
Rabbit -
Tested applications
Suitable for: ICC/IF, WB, IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Spir-1 aa 374-474. This sequence can be found also in Isoforms 3 and 4, but not in Isoform 1.
Sequence:LEEIKAERKLRPVSPEEIRRSRLDVTTPESTKNLVESSMVNGGLTSQTKE NGLSTSQQVPAQRKKLLRAPTLAELDSSESEEETLHK
Database link: Q08AE8-2 -
Positive control
- WB: RT4 and U-251 MG whole cell lysates; IHC-P: Human lateral ventricle tissue; ICC: U-2 OS whole cells.
-
General notes
Store product undiluted. For continuous use, store at 2-8°C for one-two days. Working dilution samples should be discarded if not used within 12 hours. The antibody solution should be gently mixed before use.
This antibody is mono-specific.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab130403 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
ICC/IF |
Use a concentration of 0.25 - 2 µg/ml.
Fixation/Permeabilization: PFA/Triton X-100 |
|
WB |
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 86 kDa.
|
|
IHC-P |
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. Fixation/Permeabilization: PFA/Triton X-100 |
WB
Use a concentration of 0.04 - 0.4 µg/ml. Predicted molecular weight: 86 kDa. |
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Acts as a actin nucleation factor, remains associated with the slow-growing pointed end of the new filament. Involved in vesicle transport processes providing a novel link between actin organization and intracellular transport. -
Sequence similarities
Belongs to the spire family.
Contains 1 KIND domain.
Contains 2 WH2 domains. -
Domain
Binds to actin monomers via the WH2 domain.
The Spir-box targets binding to intracellular membrane structures. -
Cellular localization
Cytoplasm > cytoskeleton. Cytoplasm > perinuclear region. Punctate spots in perinuclear region and cytoplasm, co-localised with Rab11. - Information by UniProt
-
Database links
- Entrez Gene: 56907 Human
- Omim: 609216 Human
- SwissProt: Q08AE8 Human
- Unigene: 515283 Human
-
Alternative names
- KIAA1135 antibody
- MGC150621 antibody
- MGC150622 antibody
see all
Images
-
Immunocytochemical analysis of U-2 OS (Human bone osteosarcoma epithelial cell line) whole cells labeling Spir-1 in the nucleoplasm and cytosol with ab130403 antibody at 2 µg/ml.
-
Immunohistochemical analysis of paraffin embedded human lateral ventricle tissue labeling Spir-1 in the nucleus of neuronal cells with ab130403 antibody at a 1/500 dilution.
Performed heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
-
All lanes : Anti-Spir-1 antibody (ab130403) at 0.4 µg/ml
Lane 1 : RT4 (Human urinary bladder cancer cell line) whole cell lysate
Lane 2 : U-251 MG (formally U-373 MG) (Human brain glioma cell line) whole cell lysate
Predicted band size: 86 kDa
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab130403 has not yet been referenced specifically in any publications.