You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Seladin 1 protein (Tagged-His Tag) (ab92067)

Submit an Abreview Submit a Question

Overview

  • Product nameSeladin 1 protein (Tagged-His Tag)See all Seladin 1 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 289-516 (228 amino acids) of Human Seladin 1 with N terminal His tag; MWt 27kDa (UniProt Q15392).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 149 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesEPSKLNSIGNYYKPWFFKHVENYLKTNREGLEYIPLRHYY HRHTRSIF WELQDIIPFGNNPIFRYLFGWMVPPKISLL KLTQGETLRKLYEQHHVV QDMLVPMKCLQQALHTFQND IHVYPIWLCPFILPSQPGLVHPKGNEAE LYIDIGAYGE PRVKHFEARSCMRQLEKFVRSVHGFQMLYADCYMNREE FWEMFDGSLYHKLREKLGCQDAFPEVYDKICKAARH
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab92067 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    MS
    SDS-PAGE
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        24 dehydrocholesterol reductase24-dehydrocholesterol reductase3 beta hydroxysterol delta 24 reductase
        3-beta-hydroxysterol delta-24-reductaseDCEDelta(24)-sterol reductaseDesmosterol to cholesterol enzymeDHC24_HUMANDHCR24Diminuto dwarf1 homologDiminuto/dwarf1 homologKIAA0018Nbla03646Seladin-1SELADIN1Selective AD indicator 1Selective Alzheimer's Disease Indicator 1
      see all
  • FunctionCatalyzes the reduction of the delta-24 double bond of sterol intermediates. Protects cells from oxidative stress by reducing caspase 3 activity during apoptosis induced by oxidative stress. Also protects against amyloid-beta peptide-induced apoptosis.
  • Tissue specificityHighly expressed in brain and adrenal gland with moderate expression in liver, lung, spleen, prostate and spinal cord. Low expression in heart, uterus and prostate. Undetectable in blood cells. In the brain, strongly expressed in cortical regions, substantia nigra, caudate nucleus, hippocampus, medulla oblongata and pons. In brains affected by Alzheimer disease, expression in the inferior temporal lobe is substantially lower than in the frontal cortex.
  • PathwaySteroid biosynthesis; cholesterol biosynthesis.
  • Involvement in diseaseDesmosterolosis (DESMOS) [MIM:602398]: Rare autosomal recessive disorder characterized by multiple congenital anomalies and elevated levels of the cholesterol precursor desmosterol in plasma, tissue, and cultured cells. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similaritiesBelongs to the FAD-binding oxidoreductase/transferase type 4 family.
    Contains 1 FAD-binding PCMH-type domain.
  • Cellular localizationEndoplasmic reticulum membrane. Golgi apparatus membrane.

    • Target information above from: UniProt accession Q15392 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Seladin 1 protein (Tagged-His Tag) images

    • SDS-PAGE - Seladin 1 protein (Tagged-His Tag) (ab92067)
      SDS-PAGE - Seladin 1 protein (Tagged-His Tag) (ab92067)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Seladin 1 protein (Tagged-His Tag) (ab92067)

    ab92067 has not yet been referenced specifically in any publications.

    Publishing research using ab92067 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab92067 Submit a Question for ab92067

    There are currently no Abreviews or Questions for ab92067.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"