You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameStaufen protein (Tagged-His Tag)See all Staufen proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 329-496 (168 amino acids) of Human Staufen with an N terminal His tag. Predicted MWt: 19 kDa; UniProt ID = O95793 (Isoform Short).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 99 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Sequence notesHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTRAAPNPAKA TVTAMIARELLYGGTSPTAE TILKNNISSGHVPHGPLT RPSEQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQP PL ISHGIGKDVESCHDMAALNILKLLSELDQQSTEMPR TGNGPMSVCGRC
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91965 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
  • Application notesSDS-PAGE: Use at an assay dependent dilution.

    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        Double stranded RNA binding protein Staufen homologDouble stranded RNA binding protein Staufen homolog 1Double-stranded RNA-binding protein Staufen homolog 1
        FLJ25010MGC124588STAUSTAU1STAU1_HUMANstaufenStaufen RNA binding protein (Drosophila)Staufen RNA binding protein homolog 1Staufen, RNA binding protein, homolog 1 (Drosophila)
      see all
  • FunctionBinds double-stranded RNA (regardless of the sequence) and tubulin. May play a role in specific positioning of mRNAs at given sites in the cell by cross-linking cytoskeletal and RNA components, and in stimulating their translation at the site.
  • Tissue specificityWidely expressed. Expressed in brain, pancreas, heart, skeletal muscles, liver, lung, kidney and placenta.
  • Sequence similaritiesContains 3 DRBM (double-stranded RNA-binding) domains.
  • DomainOne of the DRDB could be involved in RER binding.
    The C-terminal contains the tubulin binding domain (TBD).
  • Cellular localizationCytoplasm. Rough endoplasmic reticulum. Localizes exclusively with the rough reticulum endoplasmic.

    • Target information above from: UniProt accession O95793 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Staufen protein (Tagged-His Tag) images

    • SDS-PAGE - Staufen protein (Tagged-His Tag) (ab91965)
      SDS-PAGE - Staufen protein (Tagged-His Tag) (ab91965)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Staufen protein (Tagged-His Tag) (ab91965)

    ab91965 has not yet been referenced specifically in any publications.

    Publishing research using ab91965 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91965 Submit a Question for ab91965

    There are currently no Abreviews or Questions for ab91965.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"