Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Epigenetics and Nuclear Signaling >> Transcription >> Polymerase associated factors >> Pol II Transcription >> TFIID
Anti-TAF9 antibody
See all TAF9 products (3) ...
Mouse polyclonal to TAF9
Reacts with
Saccharomyces cerevisiae
Fusion protein: MNGGGKNVLNKNSVGSVSEVGPDSTQEETPRDV, corresponding to amino acids 1/33 of Saccharomyces cerevisiae TAF9
MNGGGKNVLN KNSVGSVSEV GPDSTQEETP RDV
Liquid
Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 50% Glycine
Whole antiserum
This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al.PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
Polyclonal
IgG
Western blot - TAF9 antibody (ab24428)
(enlarge)
Our Abpromise guarantee covers the use of ab24428 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
WB: 1/1000. Predicted molecular weight: 17 kDa.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
TAF9 functions as a component of the DNA-binding general transcription factor complex TFIID and the regulatory transcription complex SAGA. Binding of TFIID to a promoter (with or without TATA element) is the initial step in pre-initiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3 and SPT8) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3, and TRA1), and chromatin modification through histone acetylation (GCN5).
Nuclear
Western blot - TAF9 antibody (ab24428)

All lanes : Anti-TAF9 antibody (ab24428) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 17 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
ab24428 has not yet been referenced specifically in any publications.
Publishing research using ab24428? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

All lanes : Anti-TAF9 antibody (ab24428) at 1/1000 dilution
Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a
negative control fusion protein with an irrelevant antigen at 20 ug
Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the
antigen fusion protein at 20 ug
Secondary
Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at
1/5000 dilution
Predicted band size : 17 kDa
The molecular weight of the band on the western blot does not correspond to the predicted band size above (predicted from the molecular weight of the natural protein) because of the additional mass of the fusion and because the fusion protein only contains a partial fragment of the gene.
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
