Loading...
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »Products:Signal Transduction >> Adapters >> Transmembrane
Anti-TAP1 antibody
See all TAP1 products (8) ...
Rabbit polyclonal to TAP1
WB, ELISAmore details
Reacts with
Human
Predicted to work with
Mouse, Rat, Cow
Synthetic peptide corresponding to a region within internal amino acids 504-553 (LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYL DRTPRCPPSGL) of Human TAP1 (NP_000584)
LVTFVLYQMQ FTQAVEVLLS IYPRVQKAVG SSEKIFEYLD RTPRCPPSGL
MCF7 cell lysate
Liquid
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Preservative: None
Constituents: 2% Sucrose, PBS
Concentration information loading...
Immunogen affinity purified
Polyclonal
IgG
Western blot - TAP1 antibody (ab83817)
(enlarge)
Our Abpromise guarantee covers the use of ab83817 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
ELISA: Use at an assay dependent dilution. Titer using peptide based assay: 1/1562500.
WB: Use at a concentration of 1 µg/ml. Predicted molecular weight: 87 kDa.
Not yet tested in other applications.
Optimal dilutions/concentrations should be determined by the end user.
Involved in the transport of antigens from the cytoplasm to the endoplasmic reticulum for association with MHC class I molecules. Also acts as a molecular scaffold for the final stage of MHC class I folding, namely the binding of peptide. Nascent MHC class I molecules associate with TAP via tapasin. Inhibited by the covalent attachment of herpes simplex virus ICP47 protein, which blocks the peptide-binding site of TAP. Inhibited by human cytomegalovirus US6 glycoprotein, which binds to the lumenal side of the TAP complex and inhibits peptide translocation by specifically blocking ATP-binding to TAP1 and prevents the conformational rearrangement of TAP induced by peptide binding. Inhibited by human adenovirus E3-19K glycoprotein, which binds the TAP complex and acts as a tapasin inhibitor, preventing MHC class I/TAP association. Expression of TAP1 is down-regulated by human Epstein-Barr virus vIL-10 protein, thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules.
Defects in TAP1 are a cause of bare lymphocyte syndrome type 1 (BLS1) [MIM:604571]; also called HLA class I deficiency. BLS1 is a class I antigen deficiency that is not accompanied by particular pathologic manifestations during the first years of life. Systemic infections have not been described. Chronic bacterial infections, often beginning in the first decade of life, are restricted to the respiratory tract.
Belongs to the ABC transporter superfamily. ABCB family. MHC peptide exporter (TC 3.A.1.209) subfamily.
Contains 1 ABC transmembrane type-1 domain.
Contains 1 ABC transporter domain.
The peptide-binding site is shared between the cytoplasmic loops of TAP1 and TAP2.
Endoplasmic reticulum membrane. The transmembrane segments seem to form a pore in the membrane.
Target information above from: UniProt accessionQ03518
The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010).
Western blot - TAP1 antibody (ab83817)

Anti-TAP1 antibody (ab83817) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size : 87 kDa
Observed band size : 95 kDa (why is the actual band size different from the predicted?)
ab83817 has not yet been referenced specifically in any publications.
Publishing research using ab83817? Please let us know so that we can cite the reference in this datasheet
Concentration of lot no. is
Concentration not available for this lot.
Find concentration of your lot:

Anti-TAP1 antibody (ab83817) at 1 µg/ml (in 5% skim milk / PBS buffer) + MCF7 cell lysate at 10 µg
Secondary
HRP conjugated anti-Rabbit IgG at 1/50000 dilution
Predicted band size : 87 kDa
Observed band size : 95 kDa (why is the actual band size different from the predicted?)
0
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
Call 01223 696 000 or contact us
