You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameAnti-TARDBP antibodySee all TARDBP primary antibodies ...
  • Description
    Rabbit polyclonal to TARDBP
  • Tested applicationsWB, IHC-P more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Dog
  • Immunogen

    A region within synthetic peptide: MSEYIRVTED ENDEPIEIPS EDDGTVLLST VTAQFPGACG LRYRNPVSQC, corresponding to N terminal amino acids 1-50 of Human TARDBP

  • Positive controlHepG2 cell lysate, Human liver and kidney tubules.

Properties

Applications

Our Abpromise guarantee covers the use of ab50930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB WB: Use a concentration of 1.25 µg/ml. Detects a band of approximately 45 kDa (predicted molecular weight: 45 kDa). Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
IHC-P IHC-P: Use at an assay dependent concentration.

Target

  • FunctionDNA and RNA-binding protein which regulates transcription and splicing. Involved in the regulation of CFTR splicing. It promotes CFTR exon 9 skipping by binding to the UG repeated motifs in the polymorphic region near the 3'-splice site of this exon. The resulting aberrant splicing is associated with pathological features typical of cystic fibrosis. May also be involved in microRNA biogenesis, apoptosis and cell division. Can repress HIV-1 transcription by binding to the HIV-1 long terminal repeat. Stabilizes the low molecular weight neurofilament (NFL) mRNA through a direct interaction with the 3' UTR.
  • Tissue specificityUbiquitously expressed. In particular, expression is high in pancreas, placenta, lung, genital tract and spleen.
  • Involvement in diseaseDefects in TARDBP are the cause of amyotrophic lateral sclerosis type 10 (ALS10) [MIM:612069]. ALS is a neurodegenerative disorder affecting upper and lower motor neurons and resulting in fatal paralysis. Sensory abnormalities are absent. Death usually occurs within 2 to 5 years. The etiology of ALS is likely to be multifactorial, involving both genetic and environmental factors. The disease is inherited in 5-10% of the cases.
  • Sequence similaritiesContains 2 RRM (RNA recognition motif) domains.
  • DomainThe RRM domains can bind to both DNA and RNA.
  • Post-translational
    modifications
    Hyperphosphorylated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Ubiquitinated in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
    Cleaved to generate C-terminal fragments in hippocampus, neocortex, and spinal cord from individuals affected with ALS and FTLDU.
  • Cellular localizationNucleus. In patients with frontotemporal lobar degeneration and amyotrophic lateral sclerosis, it is absent from the nucleus of affected neurons but it is the primary component of cytoplasmic ubiquitin-positive inclusion bodies.
  • Target information above from: UniProt accession Q13148 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt
  • Database links
  • Alternative names
      ALS10 antibodyOTTHUMP00000002171 antibodyOTTHUMP00000002172 antibody
      OTTHUMP00000002173 antibodyTADBP_HUMAN antibodyTAR DNA binding protein 43 antibodyTAR DNA binding protein antibodyTAR DNA-binding protein 43 antibodyTARDBP antibodyTDP 43 antibodyTDP-43 antibodyTDP43 antibody
    see all

Anti-TARDBP antibody images

  • Anti-TARDBP antibody (ab50930) at 1.25 µg/ml + HepG2 cell lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 45 kDa
    Observed band size : 45 kDa
  • Ab50930 at 4.0 µg/ml staining epithelial cells of renal tubule from Human kidney; paraffin embedded, magnification 400x.
  • Ab50930 at 4.0 µg/ml staining Human liver hepatocytes; paraffin embedded, magnification 400x.
  • Immunohistochemistry of Human Liver cell lysate tissue at an antibody concentration of 4-8µg/ml using anti-TARDBP antibody (ab50930)

  • Immunohistochemistry of Human kidney lysate tissue at an antibody concentration of 4-8µg/ml using anti-TARDBP antibody (ab50930)

References for Anti-TARDBP antibody (ab50930)

This product has been referenced in:
  • Estes PS  et al. Wild-type and A315T mutant TDP-43 exert differential neurotoxicity in a Drosophila model of ALS. Hum Mol Genet 20:2308-21 (2011). WB . Read more (PubMed: 21441568) »

See 1 Publication for this product

Product Wall

Displaying 1 - 1 of 1 results for Abreviews and Q&A

Thank you for your enquiry. We can provide you with a 50aa region from which the immunogen sequence was derived. The region is as follows: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQC I hope this information will be useful. Should you req...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"