Overview

  • Product name
    Anti-TB Ag85A antibody (FITC)
    See all TB Ag85A primary antibodies
  • Description
    Rabbit Polyclonal to TB Ag85A (FITC)
  • Conjugation
    FITC. Ex: 493nm, Em: 528nm
  • Specificity
    Reacts with Mycobacterium tuberculosis.
  • Tested applications
    Suitable for: WBmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Recombinant fragment corresponding to TB Ag85A aa 53-331. Mycobacterium tuberculosis.
    Sequence:

    YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT


    Database link: P9WQP2

  • Positive control
    • Recombinant Mycobacterium tuberculosis TB Ag85A protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C. Store In the Dark.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).

Target

  • Relevance
    Mycobacterium tuberculosis antigen 85 is a complex of three related gene products of 30-31 kDa, Ag85A, B and C. These proteins are responsible for the high affinity of mycobacteria to fibronectin. All three proteins possesses a mycolyltransferase activity - which is required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. Thus all three proteins are involved in the final stages of mycobacterial cell wall assembly.
  • Cellular localization
    Secreted; cell wall. Cytoplasm
  • Alternative names
    • 85 A antibody
    • 85A antibody
    • Ag85A antibody
    • Antigen 85 A antibody
    • Antigen 85 complex A antibody
    • Antigen 85A antibody
    • Fbp A antibody
    • FbpA antibody
    • Fibronectin binding protein A antibody
    • Mpt 44 antibody
    • Mpt44 antibody
    • Mycobacterium tuberculosis antigen 85A antibody
    • Mycolyl transferase 85 A antibody
    • Mycolyl transferase 85A antibody
    • Rv3804c antibody
    • Secreted antigen Ag85A antibody
    see all

Images

  • All lanes : Anti-TB Ag85A antibody (FITC) (ab193480) at 2 µg/ml

    Lane 1 : Recombinant Mycobacterium tuberculosis TB Ag85A protein at 1 µg
    Lane 2 : Recombinant Mycobacterium tuberculosis TB Ag85A protein at 10 µg

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Predicted band size : 36 kDa
    Observed band size : 36 kDa

References

ab193480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up