Overview

  • Product name
    Anti-TB Ag85A antibody (HRP)
    See all TB Ag85A primary antibodies
  • Description
    Rabbit polyclonal to TB Ag85A (HRP)
  • Conjugation
    HRP
  • Tested applications
    Suitable for: WB, ELISAmore details
  • Species reactivity
    Reacts with: Other
  • Immunogen

    Recombinant fragment corresponding to TB Ag85A aa 53-331. (Mycobacterium tuberculosis).
    Sequence:

    YLQVPSPSMGRDIKVQFQSGGANSPALYLLDGLRAQDDFSGWDINTPAFE WYDQSGLSVVMPVGGQSSFYSDWYQPACGKAGCQTYKWETFLTSELPGWL QANRHVKPTGSAVVGLSMAASSALTLAIYHPQQFVYAGAMSGLLDPSQAM GPTLIGLAMGDAGGYKASDMWGPKEDPAWQRNDPLLNVGKLIANNTRVWV YCGNGKPSDLGGNNLPAKFLEGFVRTSNIKFQDAYNAGGGHNGVFDFPDS GTHSWEYWGAQLNAMKPDLQRALGATPNT


    Database link: P9WQP3

  • Positive control
    • Recombinant Mycobacterium tuberculosis TB Ag85A protein.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C.
  • Storage buffer
    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity
    Caprylic Acid - Ammonium Sulfate precipitation
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193523 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 2 µg/ml. Detects a band of approximately 36 kDa (predicted molecular weight: 36 kDa).
ELISA Use at an assay dependent concentration.

Target

  • Relevance
    Mycobacterium tuberculosis antigen 85 is a complex of three related gene products of 30-31 kDa, Ag85A, B and C. These proteins are responsible for the high affinity of mycobacteria to fibronectin. All three proteins possesses a mycolyltransferase activity - which is required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. Thus all three proteins are involved in the final stages of mycobacterial cell wall assembly.
  • Cellular localization
    Secreted; cell wall. Cytoplasm
  • Alternative names
    • 85 A antibody
    • 85A antibody
    • Ag85A antibody
    • Antigen 85 A antibody
    • Antigen 85 complex A antibody
    • Antigen 85A antibody
    • Fbp A antibody
    • FbpA antibody
    • Fibronectin binding protein A antibody
    • Mpt 44 antibody
    • Mpt44 antibody
    • Mycobacterium tuberculosis antigen 85A antibody
    • Mycolyl transferase 85 A antibody
    • Mycolyl transferase 85A antibody
    • Rv3804c antibody
    • Secreted antigen Ag85A antibody
    see all

References for Anti-TB Ag85A antibody (HRP) (ab193523)

ab193523 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab193523.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up