Overview

  • Product name
  • Description
    Rabbit polyclonal to TCCR
  • Tested applications
    Suitable for: IHC-P, Flow Cytmore details
  • Species reactivity
    Reacts with: Mouse
    Predicted to work with: Rat, Human
  • Immunogen

    Synthetic peptide within Human TCCR aa 35-80 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    SAGPLQCYGVGPLGDLNCSWEPLGDLGAPSELHLQS QKYRSNKTQT


    Database link: Q6UWB1

  • Positive control
    • Mouse lymphoma tissue; Mouse splenocytes.

Properties

Applications

Our Abpromise guarantee covers the use of ab217627 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500.
Flow Cyt 1/100.

Target

  • Function
    Receptor for IL27. Requires IL6ST/gp130 to mediate signal transduction in response to IL27. This signaling system acts through STAT3 and STAT1. Involved in the regulation of Th1-type immune responses. Also appears to be involved in innate defense mechanisms.
  • Tissue specificity
    Highly expressed in lymphoid tissues such as spleen, lymph nodes and peripheral blood leukocytes. Weakly expressed in other tissues examined including heart, brain, fetal and adult lung, liver, skeletal muscle, kidney, pancreas, prostate, testis, ovary, small intestine, kidney and colon. In the lymphoid system, higher level expression in CD4+ T-cell subsets than in CD8+ T-cell subsets. Also weaker expression in CD19+ B-cells and monocytes.
  • Sequence similarities
    Belongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 3 fibronectin type-III domains.
  • Domain
    The WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • Class I cytokine receptor antibody
    • CRL1 antibody
    • Cytokine receptor-like 1 antibody
    • I27RA_HUMAN antibody
    • IL-27 receptor subunit alpha antibody
    • IL-27R subunit alpha antibody
    • IL-27R-alpha antibody
    • IL-27RA antibody
    • IL27R alpha antibody
    • IL27R antibody
    • Il27ra antibody
    • Interleukin 27 receptor alpha chain precursor antibody
    • Interleukin 27 receptor antibody
    • Interleukin-27 receptor subunit alpha antibody
    • Protein CRL1 antibody
    • T cell cytokine receptor type 1 antibody
    • TCCR antibody
    • Type 1 T cell cytokine receptor antibody
    • Type I T-cell cytokine receptor antibody
    • WSX-1 antibody
    • WSX1 antibody
    • ZcytoR1 antibody
    see all

Anti-TCCR antibody images

  • Immunohistochemical analysis of Formalin fixed, paraffin embedded Mouse lymphoma tissue labeling TCCR with ab217627 at 1/200 followed by conjugation to the secondary antibody and DAB staining.

  • Flow cytometric analysis of Mouse splenocytes labeling TCCR with ab217627 at 1/100 dilution followed by a FITC conjugated secondary antibody (green) compared to control cells (blue).

References for Anti-TCCR antibody (ab217627)

ab217627 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab217627.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up