Anti-TCEAL6 antibody (ab108072)

Overview

• Product nameAnti-TCEAL6 antibodySee all TCEAL6 primary antibodies ...
• Description
  Rabbit polyclonal to TCEAL6
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Human
  
• Immunogen

  Synthetic peptide corresponding to a region within C terminal amino acids 134-183 (LSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDP FAQGDNGVSGE) of Human TCEAL6 (NP_001006939)

  Run BLAST with Run BLAST with
• Positive controlJurkat cell lysate

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 2% Sucrose, PBS
• Concentration information loading...
• PurityImmunogen affinity purified
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Epigenetics and Nuclear Signaling
  • Transcription
  • Other factors

Applications

Target

• FunctionMay be involved in transcriptional regulation.
• Sequence similaritiesBelongs to the TFS-II family. TFA subfamily.
• Post-translational
  modificationsPhosphorylated upon DNA damage, probably by ATM or ATR.
• Cellular localizationNucleus.

Target information above from: UniProt accession Q6IPX3 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 158931 Human
  • Entrez Gene: 158931 Human
  • SwissProt: Q6IPX3 Human
  • SwissProt: Q6IPX3 Human
  • Unigene: 447815 Human

• Alternative names
  TCAL6_HUMAN antibodyTCEA like protein 6 antibodyTCEA-like protein 6 antibody

  Tceal3 antibodyTCEAL6 antibodyTranscription elongation factor A (SII) like 3 antibodyTranscription elongation factor A (SII) like 6 antibodyTranscription elongation factor A protein like 6 antibodyTranscription elongation factor A protein-like 6 antibodyTranscription elongation factor S II protein like 6 antibodyTranscription elongation factor S-II protein-like 6 antibody

  see all

Anti-TCEAL6 antibody images

• 

  Western blot - TCEAL6 antibody (ab108072)
  Anti-TCEAL6 antibody (ab108072) at 1 µg/ml + Jurkat cell lysate at 10 µg
  
  Predicted band size : 20 kDa