Overview

  • Product nameAnti-TCEAL6 antibody
    See all TCEAL6 primary antibodies
  • Description
    Rabbit polyclonal to TCEAL6
  • Tested applicationsWBmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 134-183 (LSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAQGDNGVSG E) of Human TCEAL6 (NP_001006939)

  • Positive control
    • Jurkat cell lysate

Properties

  • FormLiquid
  • Storage instructionsShipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 2% Sucrose, PBS
  • Concentration information loading...
  • PurityImmunogen affinity purified
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab108072 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 20 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionMay be involved in transcriptional regulation.
  • Sequence similaritiesBelongs to the TFS-II family. TFA subfamily.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localizationNucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • TCAL6_HUMAN antibody
    • TCEA like protein 6 antibody
    • TCEA-like protein 6 antibody
    • Tceal3 antibody
    • TCEAL6 antibody
    • Transcription elongation factor A (SII) like 3 antibody
    • Transcription elongation factor A (SII) like 6 antibody
    • Transcription elongation factor A protein like 6 antibody
    • Transcription elongation factor A protein-like 6 antibody
    • Transcription elongation factor S II protein like 6 antibody
    • Transcription elongation factor S-II protein-like 6 antibody
    see all

Anti-TCEAL6 antibody images

  • Anti-TCEAL6 antibody (ab108072) at 1 µg/ml + Jurkat cell lysate at 10 µg

    Predicted band size : 20 kDa

References for Anti-TCEAL6 antibody (ab108072)

ab108072 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab108072.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"