Overview

  • Product name
  • Description
    Rabbit polyclonal to TCF12
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TCF12 aa 27-168.
    Sequence:

    FSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGF TDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGL PGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRP


    Database link: Q99081

  • Positive control
    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function
    Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems.
  • Tissue specificity
    Expressed in several tissues and cell types including skeletal muscle, thymus, and a B-cell line.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain
    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHb20 antibody
    • Class B basic helix-loop-helix protein 20 antibody
    • DNA binding protein HTF4 antibody
    • DNA-binding protein HTF4 antibody
    • E box binding protein antibody
    • E-box-binding protein antibody
    • HEB antibody
    • Helix loop helix transcription factor 4 antibody
    • HsT17266 antibody
    • HTF4 antibody
    • HTF4_HUMAN antibody
    • TCF-12 antibody
    • Tcf12 antibody
    • Transcription factor 12 antibody
    • Transcription factor HTF-4 antibody
    • Transcription factor HTF4 antibody
    see all

Anti-TCF12 antibody images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RH-30 cells stained for TCF12 (green) using ab222040 at 4 µg/ml in ICC/IF.

References for Anti-TCF12 antibody (ab222040)

ab222040 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab222040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up