Overview

  • Product name
  • Description
    Rabbit polyclonal to TCF12
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human TCF12 aa 27-168.
    Sequence:

    FSPPVNSGKTRPTTLGSSQFSGSGIDERGGTTSWGTSGQPSPSYDSSRGF TDSPHYSDHLNDSRLGAHEGLSPTPFMNSNLMGKTSERGSFSLYSRDTGL PGCQSSLLRQDLGLGSPAQLSSSGKPGTAYYSFSATSSRRRP


    Database link: Q99081

  • Positive control
    • ICC/IF: RH-30 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab222040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Target

  • Function
    Binds specifically to oligomers of E-box motifs. May play important roles during development of the nervous system as well as in other organ systems.
  • Tissue specificity
    Expressed in several tissues and cell types including skeletal muscle, thymus, and a B-cell line.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Domain
    the 9aaTAD motif is a transactivation domain present in a large number of yeast and animal transcription factors.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • bHLHb20 antibody
    • Class B basic helix-loop-helix protein 20 antibody
    • DNA binding protein HTF4 antibody
    • DNA-binding protein HTF4 antibody
    • E box binding protein antibody
    • E-box-binding protein antibody
    • HEB antibody
    • Helix loop helix transcription factor 4 antibody
    • HsT17266 antibody
    • HTF4 antibody
    • HTF4_HUMAN antibody
    • TCF-12 antibody
    • Tcf12 antibody
    • Transcription factor 12 antibody
    • Transcription factor HTF-4 antibody
    • Transcription factor HTF4 antibody
    see all

Images

  • 4% paraformaldehyde-fixed, 0.1% Triton X-100 permeabilized RH-30 cells stained for TCF12 (green) using ab222040 at 4 µg/ml in ICC/IF.

References

ab222040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up