Anti-TIMP2 antibody (ab180630)
Key features and details
- Rabbit polyclonal to TIMP2
- Suitable for: WB, ICC/IF, IHC-P
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-TIMP2 antibody
See all TIMP2 primary antibodies -
Description
Rabbit polyclonal to TIMP2 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IF, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Rabbit, Guinea pig, Cow, Dog, Chinese hamster -
Immunogen
Recombinant full length protein corresponding to Human TIMP2 aa 27-220. Mature protein.
Sequence:CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQI KMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITL CDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMD WVTEKNINGHQAKFFACIKRSDGSCAWYRG AAPPKQEFLDIEDP
Database link: P16035 -
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 50% Glycerol, 49% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180630 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/500 - 1/2000. Predicted molecular weight: 24 kDa.
|
|
ICC/IF |
Use at an assay dependent concentration.
|
|
IHC-P |
Use at an assay dependent concentration.
ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 24 kDa. |
ICC/IF
Use at an assay dependent concentration. |
IHC-P
Use at an assay dependent concentration. ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody. |
Target
-
Function
Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. -
Sequence similarities
Belongs to the protease inhibitor I35 (TIMP) family.
Contains 1 NTR domain. -
Post-translational
modificationsThe activity of TIMP2 is dependent on the presence of disulfide bonds. -
Cellular localization
Secreted. - Information by UniProt
-
Database links
- Entrez Gene: 282093 Cow
- Entrez Gene: 403633 Dog
- Entrez Gene: 100135629 Guinea pig
- Entrez Gene: 7077 Human
- Entrez Gene: 21858 Mouse
- Entrez Gene: 100008689 Rabbit
- Entrez Gene: 29543 Rat
- Omim: 188825 Human
see all -
Alternative names
- CSC 21K antibody
- CSC-21K antibody
- CSC21K antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (52)
ab180630 has been referenced in 52 publications.
- Jiang L et al. METTL3-mediated m6A modification of TIMP2 mRNA promotes podocyte injury in diabetic nephropathy. Mol Ther 30:1721-1740 (2022). PubMed: 34995800
- Kim Y et al. HL3501, a Novel Selective A3 Adenosine Receptor Antagonist, Lowers Intraocular Pressure (IOP) in Animal Glaucoma Models. Transl Vis Sci Technol 11:30 (2022). PubMed: 35191964
- Yen JH et al. Improved Wound Healing by Naringin Associated with MMP and the VEGF Pathway. Molecules 27:N/A (2022). PubMed: 35268795
- Zhou L et al. OTX1 promotes tumorigenesis and progression of cervical cancer by regulating the Wnt signaling pathway. Oncol Rep 48:N/A (2022). PubMed: 36177903
- Wu K et al. Inhibitory effects of total triterpenoids isolated from the Hedyotis diffusa willd on H1975 cells. Front Pharmacol 13:922477 (2022). PubMed: 36188592