Anti-TLR8 antibody (ab180610)
Key features and details
- Rabbit polyclonal to TLR8
- Suitable for: WB, ICC/IF
- Reacts with: Mouse, Rat
- Isotype: IgG
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-TLR8 antibody
See all TLR8 primary antibodies -
Description
Rabbit polyclonal to TLR8 -
Host species
Rabbit -
Tested applications
Suitable for: WB, ICC/IFmore details -
Species reactivity
Reacts with: Mouse, Rat -
Immunogen
Recombinant fragment corresponding to Human TLR8 aa 849-1041.
Sequence:HHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVI NELRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTK KYAKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICK SSILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY
Database link: Q9NR97 -
Positive control
- WB: Mouse liver tissue lysate; ICC/ IF: Mouse and rat spleen.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab180610 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/500 - 1/2000. Predicted molecular weight: 120 kDa.
|
ICC/IF | (1) |
1/50 - 1/200.
|
Notes |
---|
WB
1/500 - 1/2000. Predicted molecular weight: 120 kDa. |
ICC/IF
1/50 - 1/200. |
Target
-
Function
Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. -
Tissue specificity
Detected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells. -
Sequence similarities
Belongs to the Toll-like receptor family.
Contains 23 LRR (leucine-rich) repeats.
Contains 1 LRRCT domain.
Contains 1 TIR domain. -
Cellular localization
Membrane. - Information by UniProt
-
Database links
- Entrez Gene: 170744 Mouse
- Entrez Gene: 684440 Rat
- SwissProt: P58682 Mouse
- Unigene: 196676 Mouse
-
Alternative names
- CD 288 antibody
- CD288 antibody
- CD288 antigen antibody
see all
Images
-
Immunofluorescence staining of mouse spleen tissue stained for TLR8 with ab180610 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
-
Anti-TLR8 antibody (ab180610) at 1/1000 dilution + Mouse liver tissue lysate at 25 µg
Secondary
HRP Goat AntiRabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 120 kDaBlocking buffer: 3% nonfat dry milk in TBST.
-
Immunofluorescence staining of rat spleen tissue stained for TLR8 with ab180610 at 1/100 dilution. Nuclei are labeled with DAPI (Blue).
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (7)
ab180610 has been referenced in 7 publications.
- Min HK et al. Relationship between toll-like receptor expression in the distal facial nerve and facial nerve recovery after injury. Int J Immunopathol Pharmacol 36:3946320221090007 (2022). PubMed: 35585682
- Mikhalkevich N et al. Response of human macrophages to gamma radiation is mediated via expression of endogenous retroviruses. PLoS Pathog 17:e1009305 (2021). PubMed: 33556144
- Ren F et al. TLR7/8 signalling affects X-sperm motility via the GSK3 a/ß-hexokinase pathway for the efficient production of sexed dairy goat embryos. J Anim Sci Biotechnol 12:89 (2021). PubMed: 34340711
- Yang BY et al. Datura Metel L. Ameliorates Imiquimod-Induced Psoriasis-Like Dermatitis and Inhibits Inflammatory Cytokines Production through TLR7/8-MyD88-NF-?B-NLRP3 Inflammasome Pathway. Molecules 24:N/A (2019). PubMed: 31181689
- Umehara T et al. Activation of Toll-like receptor 7/8 encoded by the X chromosome alters sperm motility and provides a novel simple technology for sexing sperm. PLoS Biol 17:e3000398 (2019). PubMed: 31408454
- Wang MX et al. Acetyl-11-keto-ß-boswellic acid inhibits the secretion of cytokines by dendritic cells via the TLR7/8 pathway in an imiquimod-induced psoriasis mouse model and in vitro. Life Sci N/A:N/A (2018). WB ; Mouse . PubMed: 29859222
- Meng Y et al. Paeonol ameliorates imiquimod-induced psoriasis-like skin lesions in BALB/c mice by inhibiting the maturation and activation of dendritic cells. Int J Mol Med 39:1101-1110 (2017). PubMed: 28339016