Anti-TRAM1/TRAM antibody (ab96106)
Key features and details
- Rabbit polyclonal to TRAM1/TRAM
- Suitable for: IHC-P, ICC/IF, WB
- Reacts with: Mouse, Human
- Isotype: IgG
Overview
-
Product name
Anti-TRAM1/TRAM antibody
See all TRAM1/TRAM primary antibodies -
Description
Rabbit polyclonal to TRAM1/TRAM -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IF, WBmore details -
Species reactivity
Reacts with: Mouse, Human -
Immunogen
Synthetic peptide within Human TRAM1 aa 310-374. The exact sequence is proprietary.
Sequence:FMMWKFINFQLRRWREHSAFQAPAVKKKPTVTKGRSSKKGT ENGVNGTLTSNVADSPRNKKEKSS
Database link: NP_055109 -
Positive control
- WB: H1299 whole cell lysate. IHC: mouse intestinal and AGS xenograft tissue. ICC/IF: HeLa cells.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. -
Storage buffer
pH: 7.00
Preservative: 0.01% Thimerosal (merthiolate)
Constituents: 1.21% Tris, 0.75% Glycine, 10% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab96106 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P |
1/100 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
|
ICC/IF |
1/100 - 1/1000.
|
|
WB |
1/500 - 1/3000. Predicted molecular weight: 43 kDa.
|
Notes |
---|
IHC-P
1/100 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
1/100 - 1/1000. |
WB
1/500 - 1/3000. Predicted molecular weight: 43 kDa. |
Target
-
Relevance
Function: Stimulatory or required for the translocation of secretory proteins across the ER membrane. Similarity: Belongs to the TRAM family. Contains 1 TLC (TRAM/LAG1/CLN8) domain. -
Cellular localization
Endoplasmic reticulum membrane; Multipass membrane protein -
Database links
- Entrez Gene: 23471 Human
- Entrez Gene: 72265 Mouse
- Omim: 605190 Human
- SwissProt: Q15629 Human
- SwissProt: Q91V04 Mouse
- Unigene: 491988 Human
- Unigene: 28765 Mouse
-
Alternative names
- PNAS 8 antibody
- PNAS8 antibody
- PRO1292 antibody
see all
Images
-
Anti-TRAM1/TRAM antibody (ab96106) at 1/1000 dilution + H1299 cell lysate at 30 µg
Predicted band size: 43 kDa
10% SDS-PAGE -
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of mouse intestine staining TRAM1 with ab96106 at 1/500 dilution.
-
Immunocytochemistry/ Immunofluorescence of methanol-fixed HeLa cells staining TRAM1 with ab96106 at 1/500 dilution (green). Costained with Hoechst 33342 (blue).
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) of AGS xenograft staining TRAM1 with ab96106 at 1/500 dilution.
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab96106 has been referenced in 3 publications.
- Wu X et al. Regulation of TRIF-mediated innate immune response by K27-linked polyubiquitination and deubiquitination. Nat Commun 10:4115 (2019). PubMed: 31511519
- Iampietro M et al. Ebola virus glycoprotein directly triggers T lymphocyte death despite of the lack of infection. PLoS Pathog 13:e1006397 (2017). PubMed: 28542576
- Yew KH et al. Human cytomegalovirus induces TLR4 signaling components in monocytes altering TIRAP, TRAM and downstream interferon-beta and TNF-alpha expression. PLoS One 7:e44500 (2012). WB . PubMed: 22970235