Anti-TRAPPC8 antibody (ab122692)
Key features and details
- Rabbit polyclonal to TRAPPC8
- Suitable for: IHC-P, ICC/IF
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-TRAPPC8 antibody -
Description
Rabbit polyclonal to TRAPPC8 -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, ICC/IFmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human TRAPPC8 aa 111-204 (N terminal).
Sequence:DYDLNISATTPWFESYRETFLQSMPASDHEFLNHYLACMLVASSSEAEPV EQFSKLSQEQHRIQHNSDYSYPKWFIPNTLKYYVLLHDVSAGDE
Database link: Q9Y2L5 -
Positive control
- Human testis tissue.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 40% Glycerol (glycerin, glycerine), 59% PBS -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab122692 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | (1) |
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
ICC/IF | (1) |
Use a concentration of 0.25 - 2 µg/ml.
|
Notes |
---|
IHC-P
1/500 - 1/1000. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
ICC/IF
Use a concentration of 0.25 - 2 µg/ml. |
Target
-
Function
May play a role in vesicular transport from endoplasmic reticulum to Golgi. -
Sequence similarities
Belongs to the TRS85 family. -
Cellular localization
Golgi apparatus > cis-Golgi network. - Information by UniProt
-
Database links
- Entrez Gene: 22878 Human
- Omim: 614136 Human
- SwissProt: Q9Y2L5 Human
- Unigene: 202001 Human
-
Alternative names
- General sporulation gene 1 homolog antibody
- GSG1 antibody
- HsT2706 antibody
see all
Images
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (3)
ab122692 has been referenced in 3 publications.
- Rawlins LE et al. Biallelic variants in TRAPPC10 cause a microcephalic TRAPPopathy disorder in humans and mice. PLoS Genet 18:e1010114 (2022). PubMed: 35298461
- Stanga D et al. TRAPPC11 functions in autophagy by recruiting ATG2B-WIPI4/WDR45 to preautophagosomal membranes. Traffic 20:325-345 (2019). PubMed: 30843302
- Feng ZZ et al. The Salmonella effectors SseF and SseG inhibit Rab1A-mediated autophagy to facilitate intracellular bacterial survival and replication. J Biol Chem 293:9662-9673 (2018). PubMed: 29610274