Anti-TRPM4 antibody [OTI10H5] (ab123936)
Key features and details
- Mouse monoclonal [OTI10H5] to TRPM4
- Suitable for: WB, IHC-P
- Reacts with: Dog, Human, African green monkey
- Isotype: IgG1
Overview
-
Product name
Anti-TRPM4 antibody [OTI10H5]
See all TRPM4 primary antibodies -
Description
Mouse monoclonal [OTI10H5] to TRPM4 -
Host species
Mouse -
Tested applications
Suitable for: WB, IHC-Pmore details -
Species reactivity
Reacts with: Dog, Human, African green monkey -
Immunogen
Recombinant full length protein corresponding to Human TRPM4 aa 1-1214. Produced in HEK-293T cells (NP_060106).
Sequence:MVVPEKEQSWIPKIFKKKTCTTFIVDSTDPGGTLCQCGRPRTAHPAVAME DAFGAAVVTVWDSDAHTTEKPTDAYGELDFTGAGRKHSNFLRLSDRTDPA AVYSLVTRTWGFRAPNLVVSVLGGSGGPVLQTWLQDLLRRGLVRAAQSTG AWIVTGGLHTGIGRHVGVAVRDHQMASTGGTKVVAMGVAPWGVVRNRDTL INPKGSFPARYRWRGDPEDGVQFPLDYNYSAFFLVDDGTHGCLGGENRFR LRLESYISQQKTGVGGTGIDIPVLLLLIDGDEKMLTRIENATQAQLPCLL VAGSGGAADCLAETLEDTLAPGSGGARQGEARDRIRRFFPKGDLEVLQAQ VERIMTRKELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLA VAWNRVDIAQSELFRGDIQWRSFHLEASLMDALLNDRPEFVRLLISHGLS LGHFLTPMRLAQLYSAAPSNSLIRNLLDQASHSAGTKAPALKGGAAELRP PDVGHVLRMLLGKMCAPRYPSGGAWDPHPGQGFGESMYLLSDKATSPLSL DAGLGQAPWSDLLLWALLLNRAQMAMYFWEMGSNAVSSALGACLLLRVMA RLEPDAEEAARRKDLAFKFEGMGVDLFGECYRSSEVRAARLLLRRCPLWG DATCLQLAMQADARAFFAQDGVQSLLTQKWWGDMASTTPIWALVLAFFCP PLIYTRLITFRKSEEEPTREELEFDMDSVINGEGPVGTADPAEKTPLGVP RQSGRPGCCGGRCGGRRCLRRWFHFWGAPVTIFMGNVVSYLLFLLLFSRV LLVDFQPAPPGSLELLLYFWAFTLLCEELRQGLSGGGGSLASGGPGPGHA SLSQRLRLYLADSWNQCDLVALTCFLLGVGCRLTPGLYHLGRTVLCIDFM VFTVRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLGVWLVAYGVATEG LLRPRDSDFPSILRRVFYRPYLQIFGQIPQEDMDVALMEHSNCSSEPGFW AHPPGAQAGTCVSQYANWLVVLLLVIFLLVANILLVNLLIAMFSYTFGKV QGNSDLYWKAQRYRLIREFHSRPALAPPFIVISHLRLLLRQLCRRPRSPQ PSSPALEHFRVYLSKEAERKLLTWESVHKENFLLARARDKRESDSERLKR TSQKVDLALKQLGHIREYEQRLKVLEREVQQCSRVLGWVAEALSRSALLP PGGPPPPDLPGSKD
Database link: Q8TD43 -
Positive control
- WB: HEK-293T cells transfected with pCMV6-ENTRY TRPM4 cDNA; HepG2, HeLa, HT-29, COS-7, Jurkat, MDCK and MCF7 cell extracts. IHC-P: Human kidney, liver, liver carcinoma, ovary and pancreas tissues.
-
General notes
Clone OTI10H5 (formerly 10H5).
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: PBS, 1% BSA, 50% Glycerol -
Concentration information loading...
-
Purity
Affinity purified -
Purification notes
Purified from cell culture supernatant by affinity chromatography. -
Clonality
Monoclonal -
Clone number
OTI10H5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab123936 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/5000 - 1/10000. Predicted molecular weight: 134 kDa.
|
|
IHC-P |
1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.
|
Notes |
---|
WB
1/5000 - 1/10000. Predicted molecular weight: 134 kDa. |
IHC-P
1/50. Perform heat mediated antigen retrieval before commencing with IHC staining protocol. |
Target
-
Function
Calcium-activated non selective (CAN) cation channel that mediates membrane depolarization. While it is activated by increase in intracellular Ca(2+), it is impermeable to it. Mediates transport of monovalent cations (Na(+) > K(+) > Cs(+) > Li(+)), leading to depolarize the membrane. It thereby plays a central role in cadiomyocytes, neurons from entorhinal cortex, dorsal root and vomeronasal neurons, endocrine pancreas cells, kidney epithelial cells, cochlea hair cells etc. Participates in T-cell activation by modulating Ca(2+) oscillations after T lymphocyte activation, which is required for NFAT-dependent IL2 production. Involved in myogenic constriction of cerebral arteries. Controls insulin secretion in pancreatic beta-cells. May also be involved in pacemaking or could cause irregular electrical activity under conditions of Ca(2+) overload. Affects T-helper 1 (Th1) and T-helper 2 (Th2) cell motility and cytokine production through differential regulation of calcium signaling and NFATC1 localization. Enhances cell proliferation through up-regulation of the beta-catenin signaling pathway. -
Tissue specificity
Widely expressed with a high expression in intestine and prostate. In brain, it is both expressed in whole cerebral arteries and isolated vascular smooth muscle cells. Prominently expressed in Purkinje fibers. Expressed at higher levels in T-helper 2 (Th2) cells as compared to T-helper 1 (Th1) cells. -
Involvement in disease
Defects in TRPM4 are the cause of progressive familial heart block type 1B (PFHB1B) [MIM:604559]. It is a cardiac bundle branch disorder characterized by progressive alteration of cardiac conduction through the His-Purkinje system, with a pattern of a right bundle-branch block and/or left anterior hemiblock occurring individually or together. It leads to complete atrio-ventricular block causing syncope and sudden death. -
Sequence similarities
Belongs to the transient receptor (TC 1.A.4) family. LTrpC subfamily. TRPM4 sub-subfamily. -
Post-translational
modificationsPhosphorylation by PKC leads to increase the sensitivity to Ca(2+).
Sumoylated. Desumoylated by SENP1. -
Cellular localization
Endoplasmic reticulum. Golgi apparatus and Cell membrane. Endoplasmic reticulum. Golgi apparatus. - Information by UniProt
-
Database links
- Entrez Gene: 484385 Dog
- Entrez Gene: 54795 Human
- Omim: 606936 Human
- SwissProt: Q8TD43 Human
- Unigene: 467101 Human
-
Alternative names
- 1110030C19Rik antibody
- AW047689 antibody
- Calcium-activated non-selective cation channel 1 antibody
see all
Images
-
All lanes : Anti-TRPM4 antibody [OTI10H5] (ab123936) at 1/5000 dilution
Lane 1 : HepG2 (Human liver hepatocellular carcinoma cell line) cell extract
Lane 2 : HeLa (Human epithelial cell line from cervix adenocarcinoma) cell extract
Lane 3 : HT-29 (Human colorectal adenocarcinoma cell line) cell extract
Lane 4 : A549 (Human lung carcinoma cell line) cell extract
Lane 5 : COS-7 (African green monkey kidney fibroblast-like cell line) cell extract
Lane 6 : Jurkat (Human T cell leukemia cell line from peripheral blood) cell extract
Lane 7 : MDCK (Canine kidney cell line) cell extract
Lane 8 : PC-12 (Rat adrenal gland pheochromocytoma cell line) cell extract
Lane 9 : MCF7 (Human breast adenocarcinoma cell line) cell extract
Lysates/proteins at 35 µg per lane.
Predicted band size: 134 kDa -
Paraffin-embedded human kidney tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human liver tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human liver carcinoma tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human ovary tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
Paraffin-embedded human pancreas tissue stained for TRPM4 with ab123936 at a 1/50 dilution in immunohistochemical analysis. Heat-induced epitope retrieval by 10 mM citric buffer, pH 6.0, 100°C for 10 minutes.
-
All lanes : Anti-TRPM4 antibody [OTI10H5] (ab123936) at 1/5000 dilution
Lane 1 : HEK-293T (Human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with pCMV6-ENTRY control cDNA
Lane 2 : HEK-293T cells transfected with pCMV6-ENTRY TRPM4 cDNA
Lysates/proteins at 5 µg per lane.
Predicted band size: 134 kDa
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab123936 has been referenced in 1 publication.
- Feng J et al. Upregulation of transient receptor potential melastatin 4 (TRPM4) in ventricular fibroblasts from heart failure patients. Pflugers Arch 473:521-531 (2021). PubMed: 33594499