Overview

  • Product name
  • Description
    Rabbit polyclonal to Tbx4
  • Tested applications
    Suitable for: ICC/IFmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Dog
  • Immunogen

    Recombinant fragment (proprietary-tag) corresponding to Human Tbx4 aa 391-529.
    Sequence:

    ACMYSGSGPEIAGVSGVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVPYQ PFPTHFTATTMMPRLPTLSAQSSQPPGNAHFSVYNQLSQSQVRERGPSAS FPRERGLPQGCERKPPSPHLNAANEFLYSQTFSLSRESS


    Database link: P57082

  • Positive control
    • U-2 OS cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220035 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

Target

  • Function
    Involved in the transcriptional regulation of genes required for mesoderm differentiation. Probably plays a role in limb pattern formation.
  • Involvement in disease
    Defects in TBX4 are the cause of small patella syndrome (SPS) [MIM:147891]; also known as ischiopatellar dysplasia or Scott-Taor syndrome. SPS is an autosomal dominant skeletal dysplasia characterized by patellar aplasia or hypoplasia and by anomalies of the pelvis and feet, including disrupted ossification of the ischia and inferior pubic rami.
  • Sequence similarities
    Contains 1 T-box DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt
  • Database links
  • Alternative names
    • SPS antibody
    • T box 4 antibody
    • T box protein 4 antibody
    • T box transcription factor TBX 4 antibody
    • T box transcription factor TBX4 antibody
    • T-box protein 4 antibody
    • T-box transcription factor TBX4 antibody
    • TBX 4 antibody
    • TBX4 antibody
    • TBX4_HUMAN antibody
    see all

Images

  • Immunofluorescent analysis of paraformaldehyde-fixed, Triton X-100 permeabilized U-2 OS cells labeling Tbx4 with ab220035 at 4 μg/ml dilution showing staining of nucleoplasm and vesicles in green.

References

ab220035 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220035.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up