You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameTuberin protein (Tagged-His Tag)See all Tuberin proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 1396-1725 (330 amino acids) of Human Tuberin Isoform 5 with N terminal His tag, MWt 38kDa (UniProt P49815-5).
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 78 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch)
  • Sequence notesISDSAPSRRGKRVERDALKSRATASNAEKVPGINPSFVFL QLYHSPFF GDESNKPILLPNESQSFERSVQLLDQIPSY DTHKIAVLYVGEGQSNSE LAILSNEHGSYRYTEFLTGL GRLIELKDCQPDKVYLGGLDVCGEDGQF TYCWHDDIMQ AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSG EDFKLGTIKGQFNFVHVIVTPLDYECNLVSLQCRKDMEGL VDTSVAKI VSDRNLPFVARQMALHANMASQVHHSRSNP TDIYPSKWIARLRHIKRL RQRICEEAAYSNPSLPLVHP PSHSKAPAQTPAEPTPGYEVGQ
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91873 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        FLJ43106LAMOTTHUMP00000158940
        OTTHUMP00000198394OTTHUMP00000198395TSC2TSC2_HUMANTSC4TuberinTuberous sclerosis 2Tuberous sclerosis 2 proteinTuberous sclerosis 2 protein homolog
      see all
  • FunctionIn complex with TSC1, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling. Stimulates weakly the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5 in vitro. Mutations in TSC2 lead to constitutive activation of RAP1A in tumors.
  • Tissue specificityLiver, brain, heart, lymphocytes, fibroblasts, biliary epithelium, pancreas, skeletal muscle, kidney, lung and placenta.
  • Involvement in diseaseDefects in TSC2 are the cause of tuberous sclerosis type 2 (TSC2) [MIM:613254]. TSC2 is an autosomal dominant multi-system disorder that affects especially the brain, kidneys, heart, and skin. It is characterized by hamartomas (benign overgrowths predominantly of a cell or tissue type that occurs normally in the organ) and hamartias (developmental abnormalities of tissue combination). Clinical symptoms can range from benign hypopigmented macules of the skin to profound mental retardation with intractable seizures to premature death from a variety of disease-associated causes.
    Defects in TSC2 are a cause of lymphangioleiomyomatosis (LAM) [MIM:606690]. LAM is a progressive and often fatal lung disease characterized by a diffuse proliferation of abnormal smooth muscle cells in the lungs. It affects almost exclusively young women and can occur as an isolated disorder or in association with tuberous sclerosis complex.
  • Sequence similaritiesContains 1 Rap-GAP domain.
  • Post-translational
    modifications    Phosphorylation at Ser-1387, Ser-1418 or Ser-1420 does not affect interaction with TSC1.
    Phosphorylation at Ser-939 and Thr-1462 by PKB/AKT1 is induced by growth factor stimulation.
  • Cellular localizationCytoplasm. Membrane. At steady state found in association with membranes.

    • Target information above from: UniProt accession P49815 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    Tuberin protein (Tagged-His Tag) images

    • SDS-PAGE - Tuberin protein (Tagged-His Tag) (ab91873)
      SDS-PAGE - Tuberin protein (Tagged-His Tag) (ab91873)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for Tuberin protein (Tagged-His Tag) (ab91873)

    ab91873 has not yet been referenced specifically in any publications.

    Publishing research using ab91873 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91873 Submit a Question for ab91873

    There are currently no Abreviews or Questions for ab91873.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"