Anti-Ubp64E antibody (ab22078)

Overview

• Product nameAnti-Ubp64E antibodySee all Ubp64E primary antibodies ...
• Description
  Mouse polyclonal to Ubp64E
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Fruit fly (Drosophila melanogaster)
  
• Immunogen

  Fusion protein: GRHITVTDLALPDLYKPRVYFYNPSLKKMKITRVYVSQSF NINLVLMSAYEMLNVEQFAPLSRCRLVAYNSSMDTIIQSL ESCTDPALTELRAANYSLDF, corresponding to amino acids 475/574 of Drosophila melanogaster Ubp64E

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Cell Biology
  • Proteolysis / Ubiquitin
  • Proteasome / Ubiquitin
  • Ubiquitin

  • Cell Biology
  • Proteolysis / Ubiquitin
  • Proteasome / Ubiquitin
  • Deubiquitination

Applications

Target

• RelevanceUbp64E is a ubiquitin specific protease, and has an effect on position effect variegation. It belongs to the peptidase C19 family.
• Cellular localizationNuclear
• Database links
  • Entrez Gene: 38644 Fruit fly (Drosophila melanogaster)
  • SwissProt: Q24574 Fruit fly (Drosophila melanogaster)
  • Unigene: 3704 Fruit fly (Drosophila melanogaster)

• Alternative names
  CG5486 antibodyDeubiquitinating enzyme 64E antibodyUbiquitin carboxyl-terminal hydrolase 64E antibody

  Ubiquitin specific processing protease 64E antibodyUbiquitin specific protease 64E antibodyUbiquitin thiolesterase 64E antibodyUBP antibodyUbp64 antibody

  see all

Anti-Ubp64E antibody images

• 

  Western blot - Ubp64E antibody (ab22078)
  All lanes : Anti-Ubp64E antibody (ab22078) at 1/1000 dilution
  
  Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
  Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution
  
  Predicted band size : 101 kDa