Overview

  • Product nameAnti-Ubp64E antibodySee all Ubp64E primary antibodies ...
  • Description
    Mouse polyclonal to Ubp64E
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Fruit fly (Drosophila melanogaster)
  • Immunogen

    Fusion protein: GRHITVTDLALPDLYKPRVYFYNPSLKKMKITRVYVSQSFNINLVLMSAY EMLNVEQFAPLSRCRLVAYNSSMDTIIQSLESCTDPALTELRAANYSLDF , corresponding to amino acids 475/574 of Drosophila melanogaster Ubp64E

  • General notesProduced from outbred CD1 mice


    This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

  • FormLiquid
  • Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
  • Storage bufferConstituents: 50% Glycerol
  • PurityWhole antiserum
  • Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
  • Clonality Polyclonal
  • IsotypeIgG
  • Research Areas

Applications

Our Abpromise guarantee covers the use of ab22078 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB
  • Application notesWB: 1/1000. Predicted molecular weight: 101 kDa.

    Not tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    This antibody has been tested in Western blot against an E.coli lysate containing the partial recombinant fusion protein used as an immunogen. We have no data on detection of endogenous protein.
  • Target

    • RelevanceUbp64E is a ubiquitin specific protease, and has an effect on position effect variegation. It belongs to the peptidase C19 family.
    • Cellular localizationNuclear
    • Database links
      • Alternative names
        • CG5486 antibody
        • Deubiquitinating enzyme 64E antibody
        • Ubiquitin carboxyl-terminal hydrolase 64E antibody
        • Ubiquitin specific processing protease 64E antibody
        • Ubiquitin specific protease 64E antibody
        • Ubiquitin thiolesterase 64E antibody
        • UBP antibody
        • Ubp64 antibody
        see all

      Anti-Ubp64E antibody images

      • All lanes : Anti-Ubp64E antibody (ab22078) at 1/1000 dilution

        Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
        Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug

        Secondary
        Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution

        Predicted band size : 101 kDa

      References for Anti-Ubp64E antibody (ab22078)

      ab22078 has not yet been referenced specifically in any publications.

      Product Wall

      There are currently no Abreviews or Questions for ab22078.
      Please use the links above to contact us or submit feedback about this product.

      Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"