You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameVAC14 protein (Tagged-His Tag)See all VAC14 proteins and peptides ...
  • Protein descriptionRecombinant fragment, corresponding to amino acids 640-782 of Human VAC14 with N terminal His tag; 143 amino acids, 18kDa (16.6kDa predicted from sequence). UniProt ID = Q08AM6.
  • Expression hostE. coli

    • Properties

  • Purification notesPurity level >85%
    This protein was expressed as an N-terminal His-tag fusion protein using Escherichia coli, and purified using Immobilized Metal Ion Affinity Chromatography. In some cases, smaller protein fragments may be present in addition to the intended expression product as a result of premature termination during translation in E. coli and subsequent co-purification via the His-tag. In some cases purified proteins run at a molecular weight different to the theoretically calculated molecular weight. This may be as a result of unequally distributed charges in the amino acid sequence. Alternatively, dimerisation of the expression product can occur under oxygen limitation during expression/cultivation.
  • FormLyophilised:Reconstitute with 82 µl aqua dest.
  • Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
  • Storage bufferPreservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
  • Concentration information loading...
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Sequence notesQNYRHAYDLIQKFGDLEVTVDFLAEVDKLVQLIECPIFTY LRLQLLDVKNNPYLIKA LYGLLMLLPQSSAFQLLSHRL QCVPNPELLQTEDSLKAAPKSQKADSPSIDYAELLQ HF EKVQNKHLEVRHQRSGRGDHLDRRVVL
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab91824 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE
    MS
  • Application notesMS: Use at an assay dependent dilution.
    SDS-PAGE: Use at an assay dependent dilution.


    Not yet tested in other applications.
    Optimal dilutions/concentrations should be determined by the end user.

    • Protein info

    • Alternative names
        ArPIKfyveFLJ10305FLJ36622
        FLJ46582MGC149815MGC149816OTTHUMP00000174908Protein VAC14 homologTax1 (human T cell leukemia virus type I) binding protein 1Tax1 (human T cell leukemia virus type I) binding protein 2Tax1 binding protein 2Tax1-binding protein 2TAX1BP2TRXVAC 14vac14Vac14 homologVac14 homolog (S. cerevisiae)VAC14_HUMAN
      see all
  • FunctionThe PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol-3,5-bisphosphate (PtdIns(3,5)P2). Acts as a positive activator of PIKfyve kinase activity. Also required to maintain normal levels of phosphatidylinositol 3-phosphate (PtdIns(3)P) and phosphatidylinositol 5-phosphate (PtdIns(5)P). Plays a role in the biogenesis of endosome carrier vesicles (ECV) / multivesicular bodies (MVB) transport intermediates from early endosomes.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the VAC14 family.
    Contains 6 HEAT repeats.
  • DomainThe C-terminal domain (residues 523-782) mediates homomeric interactions and is necessary for the formation and maintenance of the PI(3,5)P2 regulatory complex.
  • Cellular localizationEndosome membrane. Microsome membrane. Mainly associated with membranes of the late endocytic pathway.

    • Target information above from: UniProt accession Q08AM6 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    VAC14 protein (Tagged-His Tag) images

    • SDS-PAGE - VAC14 protein (Tagged-His Tag) (ab91824)
      SDS-PAGE - VAC14 protein (Tagged-His Tag) (ab91824)
      The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

    References for VAC14 protein (Tagged-His Tag) (ab91824)

    ab91824 has not yet been referenced specifically in any publications.

    Publishing research using ab91824 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit an Abreview for ab91824 Submit a Question for ab91824

    There are currently no Abreviews or Questions for ab91824.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"