Anti-VEGF Receptor 3 antibody (ab27278)

Yes, I will buy ab27278. I need to proceed with the purchase. Abcam will receive a PO tomorrow.

ANSWER:

I am very pleased to hear you would like to accept our offer and test ab27278 in porcine tissues. This code will give you 1 free PRIMARY ANTIBODY before the expiration date. To redeem this offer, please submit an Abreview for porcine tissues and include this code in the “Additional Comments” section so we know the Abreview is for this promotion. For more information on how to submit an Abreview, please visit the site: www.abcam.com/Abreviews.

Remember, we publish both positive and negative Abreviews on our datasheets so please submit the results of your tests. The code will be active once the Abreview has been submitted and can be redeemed in one of the following ways: 1) Call to place your order and mention the code to our customer service department; 2) Include the code in your fax order; 3) Place your order on the web and enter the promotional code.

Any feedback that you can provide will be greatly appreciated, whether positive or negative. If you have any further questions, please do not hesitate to contact us. We look forward to receiving your Abreview and wish you luck with your research.

The terms and conditions applicable to this offer can be found here: www.abcam.com/collaborationdiscount.

What would you recommend for a VEGFR3 antibody for pig tissues? I know you have few more anti-VEGFR3 ? Also, I am eligible for a discount if i try it in pigs ? I will provide pictures of western . immuno, etc...

ANSWER:

I would be comfortable recommending this product for a number of reasons. The amino acid changes are minimal, the polarities remain the same and the hydropathy of the amino acids are similar. There should be minimal or no issues from this.

The only concern is whether the epitope recognized contains this 4aa area in which all these substitutions occur. However, as this is a polyclonal antibody it will have multiple epitope sites recogned. Therefore, as the remaining areas are intact, you should see good reactivity.


To our knowledge, this has not been tested in porcine. Therefore, I can offer a discount off a future purchase if you buy ab27278 now, test it in pig and submit feedback to us in the form of an Abreview. It doesn’t matter whether the Abreview is positive or negative, we would just really like to receive your feedback. The discount would be to the value of 1 free PRIMARY ANTIBODY.

If you are interested in this offer, please follow these steps:

1. Reply to this e-mail to let me know that you would like to proceed and test ab27278in pig. I will then send a discount code. This code must be issued before purchasing ab27278 so please wait for my reply before ordering.

2. Purchase either by phone, fax, or online (www.abcam.com).

3. Test it in pig.

4. Let us know the results, positive or negative, using our Abreview system (this will take about 10 minutes and images are great if you have them!). To find out how to submit an Abreview, please visit: http://www.abcam.com/abreviews.

5. After the review is submitted to us, the discount code becomes active. Simply place your new order by phone, fax, or on the web and mention the discount code. The discount can be redeemed for any PRIMARY ANTIBODY ordered and the discount code is valid for 4 months after issue.

We are always pleased to obtain feedback about our products and any information is greatly appreciated! Even if ab27278 turns out to be unsuitable for pig, you will still receive the discount on your next purchase after your Abreview has been submitted.

Please let me know if you have any questions about this offer and I would be happy to help you further.

The Terms and Conditions of this offer can be found at: www.abcam.com/collaborationdiscount.

I want to buy the antibody ab27278 (VEGFR3). I have the pig sequence (below). Can you please check for homology with the epitope sequence used to make this antibody?

PIG VEGFR3 (FLT4)

LQAAGSLGWRLPVVLGPYSPGPASGYSMTPPTLNITEETHIIDSSDSLSISCRGQHPLEW AWPGAQDAPVMGEKDSEDTGIVRDCEGTDTRPYCKVLLLQEAHANDTGSYRCYYKYIKAR IEGTTAASTYVFVRDPEQPFINKPDTLLVNRKDSMWVPCRVSIPGLNITLRSQSSVLRPD GQEVVWDDRRGMRVPTPLLRDALYLQCETSWGGQAFLSNPFLVHITGNELYDIQLFPKKS LELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGRWVPERRSQQTHTELSSILTIHN VSQHDLGPYVCQANNGIQQFQESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLA AYPLPEFQWYKDRKALSGRHSPHALVLKEVTEASAGIYTLALWNSAAGLRRNISLELVVN VPPHIHEKEASSPSIYSRHSRQALTCTAYGVPPPLGIQWHWRPWTPCKTFTQRSLHRRQQ RDRMPQCRDWREVTTQDAINPIESLDTWTEFVEGKNKTVSKLVIQDANVSAMYKCVVFNK VGQDERLIYFYVTTIPDGFSIESEPSEEPLEGQTVRLSCRADNYTYEHLRWYRLNLSMLH DAHGNPLLLDCKNVHLFATPLAASLEEAAPGVRHATLSLTIPSVALEHEGDYVCEVQDRR SHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLA EESGIDLTDSNQKLSIRRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVIL VGTGVIAVFFWVLLLLIFCNMRRPTHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWE FPRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKI LIHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRAKREAFNPYAEKTLEQRRR FRSMVESAKADRRRPGTSDRALLTKLLTGKGGAGRAPLVQEAEDLWLSPLTMEDLVCYSF QVARGMEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLK WMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKEGTRMRAPEL ATPAIRRIMLSCWAGEPKERPAFSDLVEILGDLLQAGSRQEEEDCLAPCDSQSSEEGSFL QASTTALHVAEADTDAEDSPPSLHRHSLAARYYNCVSFPGCLARGSQTQGPSRMKTFEEF PMTPTTYKASADNQTDSGMVLASEEFERLENRHRQEGKLSCKGPGRNADVTAVHPDPQGR WRRPDRGARGQVFYNSEYGELAGPQEEGDSTPSTHVPFFTDNSY

ANSWER:

Thank you for contacting us.

This product has an 81% identity with pig VEGFR3. Of the three non-matched amino acids within the overlap, the variations are as follows: Q1286 - R1288

I1287 - L1289

S1289 - N1291

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.