Anti-Vps16 antibody (ab21868)

Overview

• Product nameAnti-Vps16 antibodySee all VPS16 primary antibodies ...
• Description
  Mouse polyclonal to Vps16
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Fruit fly (Drosophila melanogaster)
  
• Immunogen

  Fusion protein: KEAERIRSDFKVPDRRFWWLRILTLSSQHKWEELEKLAKS KKSPIGYDPFVEVCLKQDNVMEARKYIPRCRDNRRVVWYM RANLFNEAIDSAFEQRDVHS, corresponding to amino acids 684/783 of Drosophila melanogaster Vps16.

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Signal Transduction
  • Protein Trafficking
  • Organelle Proteins

Applications

Target

• RelevanceVPS16 may play a role in vesicle mediated protein trafficking to lysosomal compartments and in membrane docking/fusion reactions of late endosomes/lysosomes.
• Cellular localizationEndosome; late endosome; late endosomal membrane; peripheral membrane protein. Lysosome; lysosomal membrane; peripheral membrane protein. Cytoplasmic, peripheral membrane protein associated with late endosomes/lysosomes.

• Alternative names
  HGNC:14584 antibodyhVPS16 antibodymVPS16 antibody

  RP11 12M19.2 antibodyVacuolar protein sorting 16 (yeast) antibodyVacuolar protein sorting 16 (Yeast), isoform CRA_a antibodyVacuolar protein sorting 16 antibodyVacuolar protein sorting 16 homolog (S. cerevisiae) antibodyvacuolar protein sorting associated protein 16 homolog antibodyVacuolar protein sorting protein 16 antibodyVPS16A antibody

  see all

Anti-Vps16 antibody images

• 

  Western blot - Vps16 antibody (ab21868)
  All lanes : Anti-Vps16 antibody (ab21868) at 1/1000 dilution
  
  Lane 1 : Total protein extract from E. coli with ~50ng to 100ng of a negative control fusion protein with an irrelevant antigen at 20 ug
  Lane 2 : Total protein extract from E. coli with ~50ng to 500ng of the antigen fusion protein at 20 ug
  
  Secondary
  Rabbit anti-mouse IgG + IgM, (H+L) horseradish peroxidase conjugated at 1/5000 dilution
  
  Predicted band size : 96 kDa