Overview

  • Product nameAnti-WBP2 antibodySee all WBP2 primary antibodies ...
  • Description
    Rabbit polyclonal to WBP2
  • Tested applicationsWB more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Chicken, Guinea pig, Cow, Cat, Dog
  • Immunogen

    Synthetic peptide corresponding to a region within N-terminal amino acids 35-85, MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQ , of Human WBP2 (NP_036610).

  • Positive control
    • Human Fetal Thymus Lysate

Applications

Our Abpromise guarantee covers the use of ab98184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 28 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

Anti-WBP2 antibody images

  • Anti-WBP2 antibody (ab98184) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human Fetal Thymus Lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 28 kDa

References for Anti-WBP2 antibody (ab98184)

ab98184 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"