Anti-WBP2 antibody (ab98184)

Overview

• Product nameAnti-WBP2 antibodySee all WBP2 primary antibodies ...
• Description
  Rabbit polyclonal to WBP2
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Human
  Predicted to work with: Mouse, Rat
• Immunogen

  Synthetic peptide corresponding to a region within N-terminal amino acids 35-85, MKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPF YLMKDCEIKQ, of Human WBP2 (NP_036610).

  Run BLAST with Run BLAST with
• Positive controlHuman Fetal Thymus Lysate

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 2% Sucrose, PBS
• Concentration information loading...
• PurityImmunogen affinity purified
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Signal Transduction
  • Signaling Pathway
  • Nuclear Signaling
  • Nuclear Hormone Receptors
  • Progesterone

  • Signal Transduction
  • Signaling Pathway
  • Nuclear Signaling
  • Nuclear Hormone Receptors
  • Co-activators/co-repressors

  • Signal Transduction
  • Signaling Pathway
  • Nuclear Signaling
  • Nuclear Hormone Receptors
  • Estrogen

  • Epigenetics and Nuclear Signaling
  • Nuclear Signaling Pathways
  • Nuclear Receptors
  • Co-activators/co-repressors

  • Epigenetics and Nuclear Signaling
  • Nuclear Signaling Pathways
  • Nuclear Receptors
  • Progesterone

  • Epigenetics and Nuclear Signaling
  • Nuclear Signaling Pathways
  • Nuclear Receptors
  • Estrogen

Applications

Target

• Tissue specificityUbiquitous.
• Sequence similaritiesContains 1 GRAM domain.
• DomainThe WW-binding 1 motif mediates interaction with NEDD4.

Target information above from: UniProt accession Q969T9 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 23558 Human
  • Entrez Gene: 22378 Mouse
  • Entrez Gene: 192645 Rat
  • Omim: 606962 Human
  • SwissProt: Q969T9 Human
  • SwissProt: P97765 Mouse
  • SwissProt: Q8R478 Rat
  • Unigene: 514489 Human

  • Unigene: 284792 Mouse
  • Unigene: 198920 Rat

  see all

• Alternative names
  MGC18269 antibodyWBP 2 antibodyWBP-2 antibody

  Wbp2 antibodyWBP2_HUMAN antibodyWW domain binding protein 2 antibodyWW domain-binding protein 2 antibody

  see all

Anti-WBP2 antibody images

• 

  Western blot - WBP2 antibody (ab98184)
  Anti-WBP2 antibody (ab98184) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human Fetal Thymus Lysate at 10 µg
  
  Secondary
  HRP conjugated anti-Rabbit IgG at 1/50000 dilution
  
  Predicted band size : 28 kDa