Anti-WFS1 antibody (ab176909)
Key features and details
- Rabbit polyclonal to WFS1
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-WFS1 antibody
See all WFS1 primary antibodies -
Description
Rabbit polyclonal to WFS1 -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Recombinant fragment corresponding to Human WFS1 aa 76-282. BC030130.
Sequence:GTGPTKGDMEIPFEEVLERAKAGDPKAQTEVGKHYLQLAGDTDEELNSCT AVDWLVLAAKQGRREAVKLLRRCLADRRGITSENEREVRQLSSETDLERA VRKAALVMYWKLNPKKKKQVAVAELLENVGQVNEHDGGAQPGPVPKSLQK QRRMLERLVSSESKNYIALDDFVEITKKYAKGVIPSSLFLQDDEDDDELA GKSPEDL
Database link: O76024 -
Positive control
- Human fetal heart and Human fetal muscle lysates.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Lyophilized:Reconstitute in 200ul sterile H2O. -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 98% PBS, 1% BSA -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab176909 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB |
1/200 - 1/1000. Detects a band of approximately 100 kDa (predicted molecular weight: 100 kDa).
|
Notes |
---|
WB
1/200 - 1/1000. Detects a band of approximately 100 kDa (predicted molecular weight: 100 kDa). |
Target
-
Relevance
WFS1 is a novel component of Wolfram syndrome, a rare form of juvenile diabetes. WFS1 plays an important role in maintaining homeostasis of the endoplasmic reticulum (ER) in the pancreas. It is normally up-regulated during insulin secretion, whereas inactivation of the protein can cause ER stress. Chronic ER stress is a major involvement in Wolfram syndrome. -
Cellular localization
Endoplasmic reticulum; endoplasmic reticulum membrane; multipass membrane protein -
Database links
- Entrez Gene: 7466 Human
- Entrez Gene: 22393 Mouse
- Omim: 606201 Human
- SwissProt: O76024 Human
- SwissProt: P56695 Mouse
-
Alternative names
- CTRCT41 antibody
- DFNA14 antibody
- DFNA38 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (1)
ab176909 has been referenced in 1 publication.
- Szocs S et al. Neurogliaform cells mediate feedback inhibition in the medial entorhinal cortex. Front Neuroanat 16:779390 (2022). PubMed: 36003850