Overview

  • Product nameAnti-A2BP1 / Fox1 antibody
    See all A2BP1 / Fox1 primary antibodies
  • Description
    Rabbit polyclonal to A2BP1 / Fox1
  • Tested applicationsWB, ELISAmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 346-395 (

    TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALVP

    ) of Human A2BP1/ Fox1 (NP_665900)

  • Positive control
    • Human fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

  • FunctionRNA-binding protein that regulates alternative splicing events by binding to 5'-UGCAUGU-3' elements. Regulates alternative splicing of tissue-specific exons and of differentially spliced exons during erythropoiesis.
  • Tissue specificityPredominantly expressed in muscle and brain.
  • Sequence similaritiesContains 1 RRM (RNA recognition motif) domain.
  • Cellular localizationNucleus. Cytoplasm.
  • Information by UniProt
  • Database links
  • Alternative names
    • 2BP1 antibody
    • A2 BP1 antibody
    • A2BP 1 antibody
    • A2BP antibody
    • A2BP1 antibody
    • Ataxin 2 binding protein 1 antibody
    • Ataxin-2-binding protein 1 antibody
    • Ataxin2 binding protein 1 antibody
    • FOX 1 antibody
    • Fox-1 homolog A antibody
    • fox-1-like RNA-binding protein 1 antibody
    • FOX1 antibody
    • Hexaribonucleotide binding protein 1 antibody
    • Hexaribonucleotide-binding protein 1 antibody
    • HRNBP 1 antibody
    • HRNBP1 antibody
    • RBFOX1 antibody
    • RFOX1_HUMAN antibody
    • RNA binding protein fox-1 homolog 1 antibody
    • RNA binding protein fox-1 homolog 1, C. elegans, homolog of, 1 antibody
    • RNA binding protein, fox-1 homolog (C. elegans) 1 antibody
    see all

Anti-A2BP1 / Fox1 antibody images

  • Anti-A2BP1 / Fox1 antibody (ab83454) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa
    Observed band size : 43 kDa
    Additional bands at : 45 kDa. We are unsure as to the identity of these extra bands.

References for Anti-A2BP1 / Fox1 antibody (ab83454)

ab83454 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"