Overview

  • Product nameAnti-A2BP1 / Fox1 antibodySee all A2BP1 / Fox1 primary antibodies ...
  • Description
    Rabbit polyclonal to A2BP1 / Fox1
  • Tested applicationsWB, ELISA more details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Horse, Cow, Dog, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within internal sequence amino acids 346-395 (TAAAYSDRNQFVFVAADEISCNTSAVTDEFMLPTPTTTHLLQPPPTALV P) of Human A2BP1/ Fox1 (NP_665900)

  • Positive control
    • Human fetal brain lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab83454 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 43 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.
ELISA Use at an assay dependent concentration.

Titre using peptide based assay: 1/1562500.

Target

Anti-A2BP1 / Fox1 antibody images

  • Anti-A2BP1 / Fox1 antibody (ab83454) at 1 µg/ml (in 5% skim milk / PBS buffer) + Human fetal brain lysate at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 43 kDa
    Observed band size : 43 kDa
    Additional bands at : 45 kDa. We are unsure as to the identity of these extra bands.

References for Anti-A2BP1 / Fox1 antibody (ab83454)

ab83454 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83454.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"