You have changed your country from  to  . Please be aware that this will change the currency in the purchasing process.

Overview

  • Product nameLAT proteinSee all LAT proteins and peptides ...
  • Protein descriptionRecombinant fragment of Human LAT isoform 2 (or b) protein (amino acids 28-233) with an N terminal His tag; 227 amino acids with the tag; predicted MWt: 24.4 kDa (UniProt ID: O43561-2).
  • Uniprot accessionO43561-2
  • Molecular weight24.400kDa inclusive of tags
  • Protein length206 amino acids
  • Expression hostE. coli

    • Properties

  • Purity> 95 % by SDS-PAGE
  • Purification notesab113124 was purified using conventional chromatography.
  • Mass spectrometryMALDI-TOF
  • FormLiquid
  • Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
  • Storage bufferpH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT
  • Concentration information loading...
  • SequenceMGSSHHHHHHSSGLVPRGSHMHCHRLPGSYDSTSSDSLYP RGIQFKRPHTVAPWPPAYPPVTSYPPLSQPDLLPIPRSPQ PLGGSHRTPSSRRDSDGANSVASYENEEPACEDADEDEDD YHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSME SIDDYVNVPESGESAEASLDGSREYVNVSQELHPGAAKTE PAALSSQEAEEVEEEGAPDYENLQELN
  • Research Areas

    • Applications

    Our Abpromise guarantee covers the use of ab113124 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Notes
    SDS-PAGE SDS-PAGE: Use at an assay dependent dilution.
    MS MS: Use at an assay dependent concentration.

    Protein info

    • Alternative names
        36 kDa phospho tyrosine adapter protein36 kDa phospho-tyrosine adapter protein36 kDa phospho-tyrosine adaptor protein
        latLAT 1LAT_HUMANLAT1Linker for activation of T cellsLinker for activation of T cells family member 1linker for activation of T cells, transmembrane adaptorLinker for activation of T-cells family member 1p36 38p36-38pp36
      see all
  • FunctionRequired for TCR (T-cell antigen receptor)- and pre-TCR-mediated signaling, both in mature T-cells and during their development. Involved in FCGR3 (low affinity immunoglobulin gamma Fc region receptor III)-mediated signaling in natural killer cells and FCER1 (high affinity immunoglobulin epsilon receptor)-mediated signaling in mast cells. Couples activation of these receptors and their associated kinases with distal intracellular events such as mobilization of intracellular calcium stores, PKC activation, MAPK activation or cytoskeletal reorganization through the recruitment of PLCG1, GRB2, GRAP2, and other signaling molecules.
  • Tissue specificityExpressed in thymus, T-cells, NK cells, mast cells and, at lower levels, in spleen. Present in T-cells but not B-cells (at protein level).
  • Post-translational
    modifications    Phosphorylated on tyrosines by ZAP-70 upon TCR activation, or by SYK upon other immunoreceptor activation; which leads to the recruitment of multiple signaling molecules. Is one of the most prominently tyrosine-phosphorylated proteins detected following TCR engagement. May be dephosphorylated by PTPRJ.
    Palmitoylation of Cys-26 and Cys-29 is required for raft targeting and efficient phosphorylation.
  • Cellular localizationCell membrane. Present in lipid rafts.

    • Target information above from: UniProt accession O43561 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

    LAT protein images

    • SDS-PAGE - LAT protein (ab113124)
      SDS-PAGE - LAT protein (ab113124)
      15% SDS-PAGE analysis of ab113124 (3 µg).
      Molecular weight on SDS-PAGE will appear higher.

    References for LAT protein (ab113124)

    ab113124 has not yet been referenced specifically in any publications.

    Publishing research using ab113124 ? Please let us know so that we can cite the reference in this datasheet

    Product Wall

    Submit a Question for ab113124

    There are currently no Questions for ab113124.
    Please use the link above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"