Anti-beta 2 Defensin antibody [B 235-I] (ab14426)

Overview

• Product nameAnti-beta 2 Defensin antibody [B 235-I]See all beta 2 Defensin primary antibodies ...
• Description
  Mouse monoclonal [B 235-I] to beta 2 Defensin
• Specificityab14426 recognises synthetic beta defensin 2.
• Tested applicationsELISA more details
• Species reactivity
  Reacts with: Human
  Predicted to work with: Chimpanzee, Macaque Monkey
• Immunogen

  Synthetic peptide: DPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP, corresponding to amino acids 4-41 of Human beta 2 Defensin.

  Run BLAST with Run BLAST with

Properties

• FormLiquid
• Storage instructionsShipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Storage bufferPreservative: None
  Constituents: 50mM Tris. pH 7.4
• Concentration information loading...
• PurityProtein L purified
• Purification notesCell culture supernatant, protein L purified.
• Clonality Monoclonal
• Clone numberB 235-I
• IsotypeIgG1
• Research Areas
  • Microbiology
  • Protein
  • Human Protein
  • Defensin

Applications

Target

• FunctionHas antibacterial activity.
• Tissue specificityExpressed in the skin and respiratory tract.
• Sequence similaritiesBelongs to the beta-defensin family. LAP/TAP subfamily.
• Cellular localizationSecreted.

Target information above from: UniProt accession O15263 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt
• Database links
  • Entrez Gene: 100289462 Human
  • Entrez Gene: 1673 Human
  • Omim: 602215 Human
  • SwissProt: O15263 Human
  • Unigene: 105924 Human
  • Unigene: 721744 Human

• Alternative names
  BD 2 antibodyBD-2 antibodyBD2 antibody

  beta 2 antibodyBeta defensin 2 antibodyBeta-defensin 2 antibodyBeta-defensin 4A antibodyDEF B2 antibodyDEF B4 antibodyDEFB 102 antibodyDEFB 2 antibodyDEFB 4 antibodyDEFB102 antibodyDEFB2 antibodyDEFB4 antibodyDEFB4B antibodyDefensin antibodyDefensin beta 2 antibodyDefensin beta 4 antibodyDFB4A_HUMAN antibodyHBD 2 antibodyhBD-2 antibodyHBD2 antibodySAP 1 antibodySAP1 antibodySkin antimicrobial peptide 1 antibodySkin-antimicrobial peptide 1 antibody

  see all