Recombinant human VEGFA protein (Active) (ab155722)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 1.000 Eu/µg
- Active: Yes
- Suitable for: ELISA, SDS-PAGE
Description
-
Product name
Recombinant human VEGFA protein (Active)
See all VEGFA proteins and peptides -
Biological activity
Measured by its binding ability in a functional ELISA. ab155722 at 2 µg/mL can bind Human VEGF R2, Strep Tag with a linear range of 0.15-2.5 µg/mL.
-
Purity
> 95 % SDS-PAGE.
ab155722 was lyophilized from 0.22 µm filtered solution. -
Endotoxin level
< 1.000 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPS CVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHN KCECRPKKDRARQEKCDKPRR -
Predicted molecular weight
14 kDa -
Amino acids
27 to 147
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab155722 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
SDS-PAGE
-
Form
Lyophilized -
Additional notes
This product is stable after storage at:
- -20°C to -70°C for 12 months in lyophilized state;
- -70°C for 3 months under sterile conditions after reconstitution.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.40
Constituents: 95% PBS, 5% Trehalose
Lyophilized from 0.22 µm filtered solution in PBS, pH7.4. Normally trehalose is added as protectant before lyophilization.This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionReconstitute with sterile deionized water to a concentration of 400 µg/ml.
General Info
-
Alternative names
- Folliculostellate cell-derived growth factor
- Glioma-derived endothelial cell mitogen
- MGC70609
see all -
Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth. -
Tissue specificity
Isoform VEGF189, isoform VEGF165 and isoform VEGF121 are widely expressed. Isoform VEGF206 and isoform VEGF145 are not widely expressed. -
Involvement in disease
Defects in VEGFA are a cause of susceptibility to microvascular complications of diabetes type 1 (MVCD1) [MIM:603933]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis. -
Sequence similarities
Belongs to the PDGF/VEGF growth factor family. -
Cellular localization
Secreted. VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin. - Information by UniProt
Images
-
SDS-PAGE of ab155722 under reducing (R) and non-reducing (NR) conditions, stained overnight with Coomassie Blue. The protein migrates as 19 kDa and 20 kDa under reducing conditions, and 40-45 kDa (homodimer) under non-reducing conditions.
-
ab155722 at 2 µg/mL can bind Human VEGF R2, Strep Tag with a linear range of 0.15-2.5 µg/mL.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab155722 has not yet been referenced specifically in any publications.