Anti-INO80 antibody (ab22238)

Overview

• Product nameAnti-INO80 antibodySee all INO80 primary antibodies ...
• Description
  Mouse polyclonal to INO80
• Tested applicationsWB more details
• Species reactivity
  Reacts with: Schizosaccharomyces pombe
  
• Immunogen

  Fusion protein: MDPSRETFDGSTRDSYKPPNGAEMMGQSELNTQNRIPYNT SANNRNWQIPLYWQQRGNEFQASPPPPLGYVTPEYGATGT PVNANNASRVDYATTAANVP, corresponding to amino acids 1/100 of Schizosaccharomyces pombe INO80

  Run BLAST with Run BLAST with
• General notesProduced from outbred CD1 mice

  
  

  This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.

Properties

• FormLiquid
• Storage instructionsStore at +4°C short term (1-2 weeks). Aliquot and store at -20°C long term. Avoid repeated freeze / thaw cycles.
• Storage bufferConstituents: 50% Glycerol
• PurityWhole antiserum
• Primary antibody notes This antibody was raised by a genetic immunization technique. Genetic immunization can be used to generate antibodies by directly delivering antigen-coding DNA into the animal, rather than injecting a protein or peptide (Tang et al. PubMed: 1545867; Chambers and Johnston PubMed: 12910245; Barry and Johnston PubMed: 9234514). The animal`s cells produce the protein, which stimulates the animal`s immune system to produce antibodies against that particular protein. A vector coding for a partial fusion protein was used for genetic immunisation of a mouse and the resulting serum was tested in Western blot against an E.coli lysate containing that partial fusion protein. Genetic immunization offers enormous advantages over the traditional protein-based immunization method. DNA is faster, cheaper and easier to produce and can be produced by standard techniques readily amenable to automation. Furthermore, the antibodies generated by genetic immunization are usually of superior quality with regard to specificity, affinity and recognizing the native protein.
• Clonality Polyclonal
• IsotypeIgG
• Research Areas
  • Epigenetics and Nuclear Signaling
  • Chromatin Remodeling
  • INO80

Applications

Target

• FunctionDNA helicase and probable main scaffold component of the chromatin remodeling INO80 complex which is involved in transcriptional regulation, DNA replication and probably DNA repair; according to PubMed:20687897 the contribution to DNA double-strand break repair appears to be largely indirect through transcriptional regulation. Recruited by YY1 to YY1-activated genes, where it acts as an essential coactivator. Binds DNA. In vitro, has double stranded DNA-dependent ATPase activity. Involved in UV-damage excision repair, DNA replication and chromosome segregation during normal cell division cycle.
• Tissue specificityAccording to PubMed:10574462, widely expressed. According to PubMed:16298340, specifically expressed in brain, liver and pancreas.
• Sequence similaritiesBelongs to the SNF2/RAD54 helicase family.
  Contains 1 DBINO domain.
  Contains 1 helicase ATP-binding domain.
  Contains 1 helicase C-terminal domain.
• DomainThe DBINO region is involved in binding to DNA.
• Cellular localizationNucleus. Colocalizes with PCNA at replication forks during S-phase. Recruited to DNA damage sites in a ACTR8-dependent manner.

Target information above from: UniProt accession Q9ULG1 The UniProt Consortium
The Universal Protein Resource (UniProt) in 2010
Nucleic Acids Res. 38:D142-D148 (2010) .

Information by UniProt

• Alternative names
  4632409L19Rik antibodyDNA helicase INO80 antibodyhINO80 antibody

  homolog of yeast INO80 antibodyINO80 antibodyINO80 complex subunit A antibodyINO80 homolog antibodyINO80_HUMAN antibodyINO80A antibodyINOC1 antibodyKIAA1259 antibodyPutative DNA helicase INO80 complex homolog 1 antibody

  see all