Overview

  • Product nameAnti-ACADS antibody
    See all ACADS primary antibodies
  • Description
    Rabbit polyclonal to ACADS
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Drosophila melanogaster, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within the internal sequence amino acids 144-193 (

    TSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEAS

    ) of Human ACADS (NP_000008).

  • Positive control
    • Fetal intestine lysate (Human)

Applications

Our Abpromise guarantee covers the use of ab87544 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 44 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • PathwayLipid metabolism; mitochondrial fatty acid beta-oxidation.
  • Involvement in diseaseDefects in ACADS are the cause of acyl-CoA dehydrogenase short-chain deficiency (ACADSD) [MIM:201470]. It is an autosomal recessive disorder resulting in acute acidosis and muscle weakness in infants, and a form of lipid-storage myopathy in adults.
  • Sequence similaritiesBelongs to the acyl-CoA dehydrogenase family.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACAD3 antibody
    • ACADS antibody
    • ACADS_HUMAN antibody
    • Acyl Coenzyme A dehydrogenase, C2 to C3 short chain antibody
    • Acyl-CoA dehydrogenase, C2 to C3 short chain antibody
    • Acyl-CoA dehydrogenase, short chain antibody
    • Acyl-Coenzyme A dehydrogenase, short chain antibody
    • AI196007 antibody
    • Bcd-1 antibody
    • Bcd1 antibody
    • Butyryl CoA dehydrogenase antibody
    • Butyryl-CoA dehydrogenase antibody
    • EC 1.3.99.2 antibody
    • mitochondrial antibody
    • SCAD antibody
    • Short chain acyl CoA dehydrogenase antibody
    • Short-chain specific acyl-CoA dehydrogenase antibody
    • Short-chain specific acyl-CoA dehydrogenase, mitochondrial antibody
    • Unsaturated acyl CoA reductase antibody
    see all

Anti-ACADS antibody images

  • Anti-ACADS antibody (ab87544) at 1 µg/ml + Fetal intestine lysate (Human) at 10 µg

    Secondary
    HRP conjugated anti-Rabbit IgG at 1/50000 dilution

    Predicted band size : 44 kDa
    Observed band size : 41 kDa (why is the actual band size different from the predicted?)

References for Anti-ACADS antibody (ab87544)

ab87544 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab87544.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"