Overview

  • Product nameAnti-ACBD3 antibody [2G2]
    See all ACBD3 primary antibodies
  • Description
    Mouse monoclonal [2G2] to ACBD3
  • Tested applicationsSuitable for: WB, Sandwich ELISA, IHC-P, ICC/IFmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human ACBD3 aa 73-171.
    Sequence:

    RRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVLMG PYNPDTCPEVGFFDVLGNDRRREWAALGNMSKEDAMVEFVKLLNRCCHL


    Database link: Q9H3P7

  • Positive control
    • WB: HeLa, PC-12, Raw 264 and NIH/3T3 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab57568 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 60 kDa.
Sandwich ELISA Use at an assay dependent concentration.

Detection limit for recombinant GST tagged ACBD3 is approximately 0.1ng/ml as a capture antibody.

IHC-P Use a concentration of 3 µg/ml.
ICC/IF Use a concentration of 10 µg/ml.

Target

  • FunctionInvolved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.
  • Tissue specificityUbiquitous, with highest expression in testis and ovary.
  • Sequence similaritiesContains 1 ACB (acyl-CoA-binding) domain.
    Contains 1 GOLD domain.
  • DomainThe GOLD domain is essential for giantin binding.
  • Cellular localizationGolgi apparatus membrane. Mitochondrion. Also mitochondrial (via its interaction with PBR).
  • Information by UniProt
  • Database links
  • Alternative names
    • ACBD 3 antibody
    • ACBD3 antibody
    • Acyl CoA binding domain containing protein 3 antibody
    • Acyl Coenzyme A binding domain containing 3 antibody
    • Acyl-CoA-binding domain-containing protein 3 antibody
    • GCP 60 antibody
    • GCP60 antibody
    • GCP60_HUMAN antibody
    • GOCAP 1 antibody
    • GOCAP1 antibody
    • Golgi complex associated protein 1 60kDa antibody
    • Golgi complex associated protein 1 antibody
    • Golgi complex-associated protein 1 antibody
    • Golgi phosphoprotein 1 antibody
    • Golgi resident protein GCP60 antibody
    • GOLPH 1 antibody
    • GOLPH1 antibody
    • PAP 7 antibody
    • PAP7 antibody
    • PBR and PKA associated protein 7 antibody
    • PBR associated protein antibody
    • PBR- and PKA-associated protein 7 antibody
    • Peripheral benzodiazepine receptor associated protein PAP7 antibody
    • Peripheral benzodiazepine receptor-associated protein PAP7 antibody
    • Peripherial benzodiazepine receptor associated protein antibody
    • PKA (RIalpha) associated protein antibody
    see all

Anti-ACBD3 antibody [2G2] images

  • Immunofluorescence of ab57568on HeLa cell (antibody concentration 10 ug/ml).

  • ACBD3 antibody (ab57568) used in immunohistochemistry at 3ug/ml on formalin fixed and paraffin embedded human small Intestine.


  • Predicted band size : 60 kDa
    ACBD3 antibody (ab57568) at 1ug/lane + HeLa cell lysate at 25ug/lane.

References for Anti-ACBD3 antibody [2G2] (ab57568)

ab57568 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab57568.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"