Overview

  • Product nameAnti-ACSF2 antibody
    See all ACSF2 primary antibodies
  • Description
    Rabbit polyclonal to ACSF2
  • Tested applicationsSuitable for: WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Guinea pig, Cow, Cat, Dog, Pig
  • Immunogen

    Synthetic peptide corresponding to a region within C terminal amino acids 403-452 (

    DLVVAYGTTENSPVTFAHFPEDTVEQKAESVGRIMPHTEARIMNMEAGTL

    ) of Human ACSF2 (NP_079425).

  • Positive control
    • Human fetal lung lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab113912 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 68 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • FunctionAcyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipodyte differentiation.
  • Sequence similaritiesBelongs to the ATP-dependent AMP-binding enzyme family.
  • Cellular localizationMitochondrion.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACSF 2 antibody
    • Acsf2 antibody
    • ACSF2_HUMAN antibody
    • ACSMW antibody
    • Acyl CoA synthetase family member 2 antibody
    • Acyl CoA synthetase family member 2 mitochondrial antibody
    • Acyl-CoA synthetase family member 2 antibody
    • AVYV493 antibody
    • FLJ20920 antibody
    • mitochondrial antibody
    • PPARG binding long chain fatty acid acyl Co A ligase like antibody
    • Putative uncharacterized protein FLJ20920 antibody
    see all

Anti-ACSF2 antibody images

  • Anti-ACSF2 antibody (ab113912) at 1 µg/ml + Human fetal lung lysate at 10 µg

    Predicted band size : 68 kDa

References for Anti-ACSF2 antibody (ab113912)

ab113912 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113912.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"