Overview

  • Product name
  • Description
    Rabbit polyclonal to ACSF3
  • Tested applications
    Suitable for: IHC-Pmore details
  • Species reactivity
    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human ACSF3 aa 365-484.
    Sequence:

    SGPLTTAVRLPGSVGTPLPGVQVRIVSENPQREACSYTIHAEGDERGTKV TPGFEEKEGELLVRGPSVFREYWNKPEETKSAFTLDGWFKTGDTVVFKDG QYWIRGRTSVDIIKTGGYKV


    Database link: Q4G176

  • Positive control
    • IHC-P: Human ovarian cancer and prostate cancer tissues.

Properties

Applications

Our Abpromise guarantee covers the use of ab222858 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Relevance
    Acyl-CoA (ACSF3) synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA and may have some preference toward very long chain substrates.
  • Cellular localization
    Mitochondrial
  • Database links
  • Alternative names
    • Acyl CoA synthetase family member 3 antibody
    • Acyl CoA synthetase family member 3 mitochondrial antibody
    • FLJ39242 antibody
    • Hypothetical protein LOC197322 antibody
    • Malonyl CoA synthetase antibody
    see all

Images

  • Paraffin-embedded human ovarian cancer tissue stained for ACSF3 using ab222858 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate cancer tissue stained for ACSF3 using ab222858 at 1/100 dilution in immunohistochemical analysis.

References

ab222858 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222858.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up