Overview

  • Product nameAnti-ACSL5 antibody
    See all ACSL5 primary antibodies
  • Description
    Rabbit polyclonal to ACSL5
  • Tested applicationsSuitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Rabbit, Horse, Chicken, Guinea pig, Cow, Cat, Dog, Pig, Zebrafish
  • Immunogen

    Synthetic peptide corresponding to a region within C-terminal amino acids 470-519

    ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

    of Human ACSL5 (NP_976313).

  • Positive control
    • Human placenta lysate

Properties

Applications

Our Abpromise guarantee covers the use of ab104892 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 4 - 8 µg/ml.
WB Use a concentration of 1 µg/ml. Detects a band of approximately 76 kDa. Good results were obtained when blocked with 5% non-fat dry milk in 0.05% PBS-T.

Target

  • RelevanceACSL5 is an isozyme of the long chain fatty acid coenzyme A ligase family. All isozymes of this family convert free long chain fatty acids into fatty acyl CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. ACSL5 is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid induced glioma cell growth. Three transcript variants encoding two different isoforms have been found.
  • Cellular localizationMitochondrion. Endoplasmic reticulum. Mitochondrion outer membrane. Endoplasmic reticulum membrane.
  • Database links
  • Alternative names
    • ACS2 antibody
    • ACS5 antibody
    • Acyl CoA synthetase 5 antibody
    • Acyl CoA synthetase long chain family member 5 antibody
    • EC 6.2.1.3 antibody
    • FACL5 antibody
    • FACL5 for fatty acid coenzyme A ligase 5 antibody
    • Fatty acid CoA ligase, long chain 5 antibody
    • Fatty acid coenzyme A ligase 5 antibody
    • Fatty acid Coenzyme A ligase long chain 5 antibody
    • LACS 5 antibody
    • Long chain acyl CoA synthetase 5 antibody
    • Long chain fatty acid CoA ligase 5 antibody
    • Long chain fatty acid coenzyme A ligase 5 antibody
    see all

Anti-ACSL5 antibody images

  • Anti-ACSL5 antibody (ab104892) at 1 µg/ml + Human placenta lysate at 10 µgGel concentration 12%
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human skeletal muscle tissue labelling ACSL5 with ab104892 at 4-8µg/ml.

References for Anti-ACSL5 antibody (ab104892)

ab104892 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104892.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"