Overview

  • Product name
    Anti-ACSS3 antibody
  • Description
    Rabbit polyclonal to ACSS3
  • Tested applications
    Suitable for: IHC-P, WBmore details
  • Species reactivity
    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human FLJ21963 aa 61-152.
    Sequence:

    EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGML NICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQ


    Database link: Q9H6R3

  • Positive control
    • Human liver tissue; RT4 cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab188009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
WB 1/100 - 1/250. Predicted molecular weight: 75 kDa.

Images

  • Anti-ACSS3 antibody (ab188009) at 1/100 dilution + RT4 cell lysate

    Predicted band size : 75 kDa
  • Immunohistochemical analysis of paraffin-embedded Human liver tissue labeling FLJ21963 with ab188009 at 1/50 dilution.

References

ab188009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up