Anti-ACTG2 antibody - N-terminal (ab189385)

Overview

  • Product name
    Anti-ACTG2 antibody - N-terminal
    See all ACTG2 primary antibodies
  • Description
    Rabbit polyclonal to ACTG2 - N-terminal
  • Tested applications
    Suitable for: WB, IHC-Pmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
  • Immunogen

    Synthetic peptide corresponding to Human ACTG2 aa 1-50 (N terminal).
    Sequence:

    MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQ


    Database link: P63267

  • Positive control
    • Human uterus and prostate tissue. Extracts from COLO205 cells.

Properties

  • Form
    Liquid
  • Storage instructions
    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer
    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, 0.87% Sodium chloride, 49% PBS

    PBS is without Mg2+, Ca2+.
  • Concentration information loading...
  • Purity
    Immunogen affinity purified
  • Clonality
    Polyclonal
  • Isotype
    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab189385 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/1000. Predicted molecular weight: 42 kDa.
IHC-P Use a concentration of 5 µg/ml. Perform heat mediated antigen retrieval before commencing with IHC staining protocol.

Target

  • Function
    Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
  • Sequence similarities
    Belongs to the actin family.
  • Post-translational
    modifications
    Oxidation of Met-45 and Met-48 by MICALs (MICAL1, MICAL2 or MICAL3) to form methionine sulfoxide promotes actin filament depolymerization. MICAL1 and MICAL2 produce the (R)-S-oxide form. The (R)-S-oxide form is reverted by MSRB1 and MSRB2, which promote actin repolymerization.
    Monomethylation at Lys-85 (K84me1) regulates actin-myosin interaction and actomyosin-dependent processes. Demethylation by ALKBH4 is required for maintaining actomyosin dynamics supporting normal cleavage furrow ingression during cytokinesis and cell migration.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt
  • Database links
  • Alternative names
    • ACT antibody
    • ACTA3 antibody
    • ACTE antibody
    • ACTG2 antibody
    • ACTH_HUMAN antibody
    • Actin antibody
    • Actin gamma 2 smooth muscle enteric antibody
    • Actin gamma enteric smooth muscle antibody
    • Actin like protein antibody
    • ACTL3 antibody
    • ACTSG antibody
    • Alpha actin 3 antibody
    • Alpha-actin-3 antibody
    • Gamma 2 actin antibody
    • Gamma-2-actin antibody
    • gamma-enteric smooth muscle antibody
    • Smooth muscle gamma actin antibody
    • Smooth muscle gamma-actin antibody
    see all

Images

  • All lanes : Anti-ACTG2 antibody - N-terminal (ab189385) at 1/500 dilution

    Lane 1 : Extracts from COLO205 cells
    Lane 2 : Extracts from COLO205 cells treated with the synthesized peptide


    Predicted band size : 42 kDa
  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human prostate tissue sections labeling ACTG2 using ab189385 at 5 µg/ml.

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded Human uterus tissue sections labeling ACTG2 using ab189385 at 5 µg/ml.

References

ab189385 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab189385.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up