Active human AKR1B1 full length protein (ab117190)

Overview

Description

  • NatureRecombinant
  • SourceE. coli
  • Amino Acid Sequence
    • AccessionP15121
    • SpeciesHuman
    • SequenceMASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQ NENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDL KLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVD EGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYC QSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLI RFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCA LLSCTSHKDYPFHEEF
    • Molecular weight36 kDa
    • Amino acids1 to 316

Specifications

Our Abpromise guarantee covers the use of ab117190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activitySpecific activity : approximately 0.5 - 0.6 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme catalyzing the oxidation of 1 micromole NADPH per minute at 25°C. Specific activity was expressed as units/mg protein.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % by SDS-PAGE.
    ab117190 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Additional NotesStore at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Please see Notes section

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General info

  • Alternative names
    • ADR
    • AKR1B 1
    • Akr1b1
    • Aldehyde reductase
    • Aldehyde reductase 1
    • Aldo keto reductase family 1, member B1
    • Aldo-keto reductase family 1 member B1
    • aldo-keto reductase family 1, member B1 (aldose reductase)
    • Aldose reductase
    • aldr 1
    • ALDR_HUMAN
    • aldr1
    • ALR2
    • AR
    • Lii5 2 CTCL tumor antigen
    • Low Km aldose reductase
    • MGC1804
    see all
  • FunctionCatalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols with a broad range of catalytic efficiencies.
  • Tissue specificityHighly expressed in embryonic epithelial cells (EUE) in response to osmotic stress.
  • Sequence similaritiesBelongs to the aldo/keto reductase family.
  • Cellular localizationCytoplasm.
  • Target information above from: UniProt accession P15121 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Active human AKR1B1 full length protein (ab117190)

ab117190 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your reply.

I spoke to the lab again and this time they were able to supply the raw data that you were asking for. This information is in the Excel file that is attached.

If there is anything else I can help you with, pl...

Read More

Thank you for contacting Abcam.

I have talked to the lab and we are unable to send you the actual raw QC data, but below is the protocol they used to test the activity of ab117190:

Activity Assay:

1. Prepare a 1ml reaction mi...

Read More

Thank you for contacting us today and your interest in our products.

I can now confirm that the specific activity figures I quoted to you over the phone did relate to the most current lot which you have received. Enzymatic activity was confir...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"