Active human c-Kit protein fragment (ab88349)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTDPGFVKWTFEIL DETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKA G IMIKSVKRAYHRLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSV SK ASYLLREGEEFTVTCTIKDVSSSVYSTWKRENSQTKLQEKYNSWHH GDF NYERQATLTISSARVNDSGVFMCYANNTFGSANVTTTLEVVDKGF INIF PMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE DYPKS ENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVY VNTKPE ILTYDRLVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLP VDVQTLN SSGPPFGKLVVQSSIDSSAFKHNGTVECKAYNDVGKTSAYF NFAFKGNN KEQIHPHTGSSNTKVDKKVEPKSCDKTHTCPPCPAPELLG GPSVFLFPP KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEV HNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYK TTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM HEALHNHYTQKSL SLSPGK
    • Amino acids23 to 520

Specifications

Our Abpromise guarantee covers the use of ab88349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity: The ED50 of ab88349 is typically 1-3 ug/ml as measured by its ability to neutralize SCF mediated proliferation using the human growth factor dependent M-07e cell line.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • C Kit
    • c-Kit
    • CD117
    • KIT
    • KIT oncogene
    • KIT_HUMAN
    • Mast cell growth factor receptor
    • Mast/stem cell growth factor receptor
    • Mast/stem cell growth factor receptor Kit
    • p145 c-kit
    • PBT
    • Piebald trait protein
    • Proto oncogene c Kit
    • Proto oncogene tyrosine protein kinase Kit
    • Proto-oncogene c-Kit
    • SCF Receptor
    • SCFR
    • soluble KIT variant 1
    • Steel Factor Receptor
    • Stem cell factor receptor
    • tyrosine protein kinase Kit
    • Tyrosine-protein kinase Kit
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene homolog
    • v kit Hardy Zuckerman 4 feline sarcoma viral oncogene like protein
    • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
    see all
  • FunctionTyrosine-protein kinase that acts as cell-surface receptor for the cytokine KITLG/SCF and plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. In response to KITLG/SCF binding, KIT can activate several signaling pathways. Phosphorylates PIK3R1, PLCG1, SH2B2/APS and CBL. Activates the AKT1 signaling pathway by phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase. Activated KIT also transmits signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. Promotes activation of STAT family members STAT1, STAT3, STAT5A and STAT5B. Activation of PLCG1 leads to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KIT signaling is modulated by protein phosphatases, and by rapid internalization and degradation of the receptor. Activated KIT promotes phosphorylation of the protein phosphatases PTPN6/SHP-1 and PTPRU, and of the transcription factors STAT1, STAT3, STAT5A and STAT5B. Promotes phosphorylation of PIK3R1, CBL, CRK (isoform Crk-II), LYN, MAPK1/ERK2 and/or MAPK3/ERK1, PLCG1, SRC and SHC1.
  • Tissue specificityIsoform 1 and isoform 2 are detected in spermatogonia and Leydig cells. Isoform 3 is detected in round spermatids, elongating spermatids and spermatozoa (at protein level). Widely expressed. Detected in the hematopoietic system, the gastrointestinal system, in melanocytes and in germ cells.
  • Involvement in diseaseDefects in KIT are a cause of piebald trait (PBT) [MIM:172800]; also known as piebaldism. PBT is an autosomal dominant genetic developmental abnormality of pigmentation characterized by congenital patches of white skin and hair that lack melanocytes.
    Defects in KIT are a cause of gastrointestinal stromal tumor (GIST) [MIM:606764].
    Defects in KIT have been associated with testicular germ cell tumor (TGCT) [MIM:273300]. A common solid malignancy in males. Germ cell tumors of the testis constitute 95% of all testicular neoplasms.
    Defects in KIT are a cause of acute myelogenous leukemia (AML) [MIM:601626]. AML is a malignant disease in which hematopoietic precursors are arrested in an early stage of development. Note=Somatic mutations that lead to constitutive activation of KIT are detected in AML patients. These mutations fall into two classes, the most common being in-frame internal tandem duplications of variable length in the juxtamembrane region that disrupt the normal regulation of the kinase activity. Likewise, point mutations in the kinase domain can result in a constitutively activated kinase.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 5 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Ubiquitinated by SOCS6. KIT is rapidly ubiquitinated after autophosphorylation induced by KITLG/SCF binding, leading to internalization and degradation.
    Autophosphorylated on tyrosine residues. KITLG/SCF binding enhances autophosphorylation. Isoform 1 shows low levels of tyrosine phosphorylation in the absence of added KITLG/SCF (in vitro). Kinase activity is down-regulated by phosphorylation on serine residues by protein kinase C family members. Phosphorylation at Tyr-568 is required for interaction with PTPN11/SHP-2, CRK (isoform Crk-II) and members of the SRC tyrosine-protein kinase family. Phosphorylation at Tyr-570 is required for interaction with PTPN6/SHP-1. Phosphorylation at Tyr-703, Tyr-823 and Tyr-936 is important for interaction with GRB2. Phosphorylation at Tyr-721 is important for interaction with PIK3R1. Phosphorylation at Tyr-823 and Tyr-936 is important for interaction with GRB7.
  • Cellular localizationCell membrane and Cytoplasm. Detected in the cytoplasm of spermatozoa, especially in the equatorial and subacrosomal region of the sperm head.
  • Information by UniProt

Active human c-Kit protein fragment images

  • 1D SDS-PAGE of ab88349 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab88349
    Lane 2: ab88349 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab88349 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.

    Appearance of additional band at lower MWt after treatment with PNGase F indicates the presence of N-linked glycans. The subsequent drop in MWt after treatment with a glycosidase cocktail indicates the presence of O-linked glycans.
  • A sample of ab88349 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 µg of protein was loaded. Spot trains indicate presence of multiple isoforms of ab88349.
  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.

References for Active human c-Kit protein fragment (ab88349)

ab88349 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us. This product has only been tested in human. I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"