Active human CD40 full length protein (ab83917)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETEC LPCGESEFLDTWN RETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEE GWHCTSEACESCVLHR SCSPGFGVKQIATGVSDTICEPCPVGFFSNVS SAFEKCHPWTSCETKDLVVQ QAGTNKTDVVCGPQDRLRRSSNTKVDKK VEPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCV VVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLH QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDEL TKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTP PVLDSDGSFFL YSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids1 to 193

Specifications

Our Abpromise guarantee covers the use of ab83917 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity: The ED50 of ab83917 is typically 1.0-1.5 ug/ml as measured by its ability to neutralize CD40 ligand mediated proliferation of T47-D cells.
  • Applications

    SDS-PAGE

    Western blot

    Functional Studies

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • AI326936
    • B cell associated molecule CD40
    • B cell surface antigen CD40
    • B cell-associated molecule
    • B-cell surface antigen CD40
    • Bp50
    • CD 40
    • CD40
    • CD40
    • CD40 antigen
    • CD40 antigen (TNF receptor superfamily member 5)
    • CD40 molecule
    • CD40 molecule, TNF receptor superfamily member 5
    • CD40 protein
    • CD40 type II isoform
    • CD40L receptor
    • CDw40
    • GP39
    • HIGM1
    • IGM
    • IMD3
    • MGC9013
    • Nerve growth factor receptor related B lymphocyte activation molecule
    • OTTHUMP00000031699
    • OTTHUMP00000031700
    • p50
    • T-BAM
    • TBAM
    • TNF receptor superfamily member 5
    • TNFRSF5
    • TNR5_HUMAN
    • TRAP
    • Tumor necrosis factor receptor superfamily , member 5
    • Tumor necrosis factor receptor superfamily member 5
    • Tumor necrosis factor receptor superfamily member 5 precursor
    • Tumor necrosis factor receptor superfamily, member 5, isoform CRA_a
    see all
  • FunctionReceptor for TNFSF5/CD40LG.
  • Tissue specificityB-cells and in primary carcinomas.
  • Involvement in diseaseDefects in CD40 are the cause of hyper-IgM immunodeficiency syndrome type 3 (HIGM3) [MIM:606843]; also known as hyper-IgM syndrome 3. HIGM3 is an autosomal recessive disorder which includes an inability of B cells to undergo isotype switching, one of the final differentiation steps in the humoral immune system, an inability to mount an antibody-specific immune response, and a lack of germinal center formation.
  • Sequence similaritiesContains 4 TNFR-Cys repeats.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Active human CD40 full length protein images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83917 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83917
    Lane 2: ab83917 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83917 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.

References for Active human CD40 full length protein (ab83917)

ab83917 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83917.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"