Active human CD62P protein fragment (ab83583)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: MANCQIAILYQRFQRVVFGISQLLCFSALISELTNQKEV AAWTYHYSTKAYSWNISRKYCQN RYTDLVAIQNKNEIDYLNKVLPYYS SYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPN NKRNNEDCVEIY IKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCS CYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDG YQVNGPSKLEC LASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKA FQHQSSCSFSCEEGFALVGPEVVQ CTASGVWTAPAPVCKAVQCQHLEA PNEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLD MLRCIDSGHWSAP LPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGA DIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCS FTCNEGLLLV GASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTC VQPLGSSSYKSTCQFICDEGYSL SGPERLDCTRSGRWTDSPPMCEAIK CPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGF KLEGPNNVECTTS GRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNT T CYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNC SNLWGNFSYG SICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGP LTIQEARSSNTKVDKKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV EVHNAKTKPREE QYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids1 to 730

Specifications

Our Abpromise guarantee covers the use of ab83583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThis protein was shown to be active by its ability to bind HL 60 cells in a cell adhesion assay in a dose dependent manner.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% HSA, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.

General info

  • Alternative names
    • Antigen CD62
    • CD62
    • CD62 antigen-like family member P
    • CD62P
    • GMP 140
    • GMP-140
    • GMP140
    • GMRP
    • Granule membrane protein 140
    • Granulocyte membrane protein
    • GRMP
    • LECAM 3
    • LECAM3
    • Leukocyte endothelial cell adhesion molecule 3
    • Leukocyte-endothelial cell adhesion molecule 3
    • LYAM3_HUMAN
    • P Selectin
    • P-selectin
    • PADGEM
    • Platelet activation dependent granule-external membrane protein
    • Platelet alpha granule membrane protein
    • PSEL
    • Selectin P (granule membrane protein 140kDa, antigen CD62)
    • SELP
    see all
  • FunctionCa(2+)-dependent receptor for myeloid cells that binds to carbohydrates on neutrophils and monocytes. Mediates the interaction of activated endothelial cells or platelets with leukocytes. The ligand recognized is sialyl-Lewis X. Mediates rapid rolling of leukocyte rolling over vascular surfaces during the initial steps in inflammation through interaction with PSGL1.
  • Tissue specificityStored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface.
  • Involvement in diseaseDefects in SELP may be a cause of susceptibility to ischemic stroke (ISCHSTR) [MIM:601367]; also known as cerebrovascular accident or cerebral infarction. A stroke is an acute neurologic event leading to death of neural tissue of the brain and resulting in loss of motor, sensory and/or cognitive function. Ischemic strokes, resulting from vascular occlusion, is considered to be a highly complex disease consisting of a group of heterogeneous disorders with multiple genetic and environmental risk factors.
  • Sequence similaritiesBelongs to the selectin/LECAM family.
    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 9 Sushi (CCP/SCR) domains.
  • Cellular localizationMembrane.
  • Target information above from: UniProt accession P16109 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Active human CD62P protein fragment (ab83583)

ab83583 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"