Active human Cripto1 protein fragment (ab84062)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPP MGIQHSKEL NRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGS VPHDTWLPK KCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE LPPSGSSNT KVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPK DTLMISRTP EVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSV LTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPR EPQVYTLPP SRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYK TTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids31 to 169

Specifications

Our Abpromise guarantee covers the use of ab84062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity200 ng/ml of this Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells.
  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Additional Notes 200 ng/ml of this Chimera induces ERK1 and ERK2 phosphorylation in human umbilical vein endothelial (HUVEC) cells.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CR
    • CRGF
    • cripto
    • Cripto 1
    • Cripto 1 growth factor
    • Cripto-1 growth factor
    • Cripto1
    • Cripto1 growth factor
    • Epidermal growth factor like cripto protein CR1
    • Epidermal growth factor-like cripto protein CR1
    • TDGF 1
    • TDGF1
    • TDGF1_HUMAN
    • Teratocarcinoma derived growth factor 1
    • Teratocarcinoma-derived growth factor 1
    see all
  • FunctionCould play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Tissue specificityPreferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
  • Sequence similaritiesContains 1 EGF-like domain.
  • Cellular localizationCell membrane.
  • Information by UniProt

Active human Cripto1 protein fragment images

  • Lane 1 – MW markers; Lane 2 – ab84062; Lane 3 – ab84062 treated with PNGase F to remove potential N linked glycans; Lane 4 – ab84062 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.
    Drop in MW after treatment with PNGase F indicates the presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • A sample of ab84062 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4 20% Tris-HCl 2D gel. Approximately 40 µg of protein was loaded; Gel was stained using Deep Purple™. The spot train indicates the presence of multiple glycoforms. Spots within the spot train were cut from the gel and identified as Cripto1 (Fc Chimera) by protein mass fingerprinting.
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates the purified human cell expressed protein exists in multiple glycoforms, which differ according to their level of post-translational modification.
    The triangle indicates theoretical pI and MW of the protein.

References for Active human Cripto1 protein fragment (ab84062)

ab84062 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"