Active human Cripto1 protein fragment (ab84064)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPP MGIQHSKELN RTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGS VPHDTWLPKKC SLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPE LPPS
    • Amino acids31 to 169

Specifications

Our Abpromise guarantee covers the use of ab84064 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab84064 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation.
  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Additional Notesab84064 has been shown to stimulate MAPK phosphorylation in HUVEC cells. 200ng/ml is sufficient to stimulate phosphorylation.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, with longer-term sto rage in aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CR
    • CRGF
    • cripto
    • Cripto 1
    • Cripto 1 growth factor
    • Cripto-1 growth factor
    • Cripto1
    • Cripto1 growth factor
    • Epidermal growth factor like cripto protein CR1
    • Epidermal growth factor-like cripto protein CR1
    • TDGF 1
    • TDGF1
    • TDGF1_HUMAN
    • Teratocarcinoma derived growth factor 1
    • Teratocarcinoma-derived growth factor 1
    see all
  • FunctionCould play a role in the determination of the epiblastic cells that subsequently give rise to the mesoderm.
  • Tissue specificityPreferentially expressed in gastric and colorectal carcinomas than in their normal counterparts.
  • Sequence similaritiesContains 1 EGF-like domain.
  • Cellular localizationCell membrane.
  • Target information above from: UniProt accession P13385 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Active human Cripto1 protein fragment images

  • Lane 1- MW markers; Lane 2- ab84064 ; Lane 3- ab84064 treated with PNGase F to remove potential N-linked glycans; Lane 4- ab84064 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.
    A drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.

    O-fucosylation at Thr-88 has been confirmed.

References for Active human Cripto1 protein fragment (ab84064)

ab84064 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab84064.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"