Active human Flt3 / CD135 protein fragment (ab83998)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: NQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESPEDLGC ALRPQSSGTVYEAAAVEVDVSASITLQVL VDAPGNISCLWVFKHSSLN CQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNT L LYTLRRPYFRKMENQDALVCISESVPEPIVEWVLCDSQGESCKEESP AVVKKEEKVLHELFGTDIRCC ARNELGRECTRLFTIDLNQTPQTTLPQ LFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM STYSTNR TMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSE DYEIDQYEEFCFS VRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISK FCNHKHQPGEYIFHAENDDAQFTKMFTLNIRRK PQVLAEASASQASCF SDGYPLPSWTWKKCSDKSPNCTEEITEGVWNRKANRKVFGQWVSSSTLNM SEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQDRIPKVDKKVEP KSCDKTHTCPPCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVD VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL TVLHQDW LNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQV SLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids1 to 540

Specifications

Our Abpromise guarantee covers the use of ab83998 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity: The ED50 of ab83998 is typically 1.0 -2.0 ng/ml as measured by its ability to neutralize Flt3 mediated proliferation of the OCI/AML5 human leukemia cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD 135
    • CD135
    • CD135 antigen
    • Fetal liver kinase 2
    • FL cytokine receptor
    • Flk 2
    • Flk2
    • Flt 3
    • FLT-3
    • Flt3
    • FLT3_HUMAN
    • FMS like tyrosine kinase 3
    • Fms related tyrosine kinase 3
    • Fms-like tyrosine kinase 3
    • Growth factor receptor tyrosine kinase type III
    • Ly-72
    • OTTHUMP0000004234
    • Receptor type tyrosine protein kinase FLT3
    • Stem cell tyrosine kinase 1
    • Stk 1
    • STK-1
    • Stk1
    • Tyrosine protein kinase receptor FLT3
    • Tyrosine-protein kinase receptor FLT3
    see all
  • FunctionReceptor for the FL cytokine. Has a tyrosine-protein kinase activity.
  • Tissue specificityBone marrow cells.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. CSF-1/PDGF receptor subfamily.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 protein kinase domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Active human Flt3 / CD135 protein fragment images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83998 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83998
    Lane 2: ab83998 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83998 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    10 µg protein loaded per lane; Deep Purple™ stained.
  • A sample of ab83998 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. 40 µg protein loaded. Spot train indicates presence of multiple isoforms.

References for Active human Flt3 / CD135 protein fragment (ab83998)

ab83998 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83998.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"