Active human GCSF Receptor protein fragment (ab83994)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPG GRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQ TQGDSILDCVPKDGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQ LCLDPMDVVKLEPPMLRTMDPSPEAAPPQAGCLQLCWEPWQPGLHINQ KCELRHKPQRGEASWALVGPLPLEALQYELCGLLPATAYTLQIRCIRW PLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVAL VAYNSAGTSRPTPVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWP QGYVIEWGLGPPSASNSNKTWRMEQNGRATGFLLKENIRPFQLYEIIV TPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGKTWAQLEWVPEPP ELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL MAASQAGATNSTVLTLMTLTPRSSNTKVDKKVEPKSCDKTHTCPPCPA PELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF SCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids25 to 621

Specifications

Our Abpromise guarantee covers the use of ab83994 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe ED50 of ab83994 is typically 2-3 ng/ml as measured by its ability to neutralize GCSF mediated proliferation of the murine myeloblastic m-NFS-60 cell line.
  • Applications

    SDS-PAGE

    Functional Studies

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD 114
    • CD114
    • CD114 antigen
    • Colony stimulating factor 3 receptor
    • Colony stimulating factor 3 receptor (granulocyte)
    • CSF 3R
    • CSF3R
    • CSF3R_HUMAN
    • Csfgr
    • G CSF R
    • G-CSF receptor
    • G-CSF-R
    • GCSFR
    • Granulocyte colony stimulating factor receptor
    • Granulocyte colony stimulating factor receptor precursor
    • Granulocyte colony-stimulating factor receptor
    • OTTHUMP00000009703
    • OTTHUMP00000009704
    • OTTHUMP00000009705
    see all
  • FunctionReceptor for granulocyte colony-stimulating factor (CSF3), essential for granulocytic maturation. Plays a crucial role in the proliferation, differientation and survival of cells along the neutrophilic lineage. In addition it may function in some adhesion or recognition events at the cell surface.
  • Tissue specificityOne or several isoforms have been found in myelogenous leukemia cell line KG-1, leukemia U937 cell line, in bone marrow cells, placenta, and peripheral blood granulocytes. Isoform GCSFR-2 is found only in leukemia U937 cells. Isoform GSCFR-3 is highly expressed in placenta.
  • Involvement in diseaseDefects in CSF3R are the cause of hereditary neutrophilia (NEUTROPHILIA) [MIM:162830]. A form of lifelong, persistent neutrophilia, a condition characterized by an increase in the number of neutrophils in the blood.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 2 subfamily.
    Contains 5 fibronectin type-III domains.
    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationSecreted and Cell membrane.
  • Information by UniProt

Active human GCSF Receptor protein fragment images

  • 1D SDS-PAGE of ab83994 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1: ab83994
    Lane 2: ab83994 treated with PNGase F to remove potential N-linked glycans
    Lane 3: ab83994 treated with a glycosidase cocktail to remove potential N- and O-linked glycans.
    Approximately 5 µg of protein was loaded per lane; Gel was stained using Coomassie.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A tightening of the band after treatment with the glycosidase cocktail indicates that O-linked glycans may be present. Additional bands in lane 2 and lane 3 are glycosidase enzymes.

References for Active human GCSF Receptor protein fragment (ab83994)

ab83994 has not yet been referenced specifically in any publications.

Product Wall


Each separate size is filled separately so that the target amount of protein of the primary product is maintained.
When each is brought to 0.5ml, each will have only 1% HSA and 10% sugar as a stabilizer. The 25ug size will be 25ug/500ul and t...

Read More


"We have our specification that was used to pass the current batch of material. The material would not have been released if it had not worked at the time of release and I've never had any complaints or reason to suspect otherwise.
Our sp...

Read More


The source of the GCSF Receptor protein ab83994 informed me that :
With regards to any of our proteins actually binding HSA, no we do not have any data, and I suppose one could get some minor binding just due to protein-protein interactions s...

Read More

Thank you for your inquiry.

I can confirm that 10% Trehalose and 1% Human serum albumin are contained in the lyophilized product.

Please follow the instructions on the datasheet for reconstitution.

I hope this information ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"