Active human IGFBP3 full length protein (ab88368)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceGASSGGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCCLTC AL SEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASA VSRL RAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKF HPLHSK IIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEYG PCRREMED TLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGR KRGFCWCVDK YGQPLPGYTTKGKEDVHCYSMQSK
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab88368 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • Acid stable subunit of the 140 K IGF complex
    • Binding protein 29
    • Binding protein 53
    • BP 53
    • BP53
    • Growth hormone dependent binding protein
    • IBP 3
    • IBP-3
    • IBP3
    • IBP3_HUMAN
    • IGF binding protein 3
    • IGF-binding protein 3
    • IGFBP 3
    • IGFBP-3
    • IGFBP3
    • Insulin Like Growth Factor Binding Protein 3
    • Insulin-like growth factor-binding protein 3
    see all
  • FunctionIGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors.
  • Tissue specificityExpressed by most tissues. Present in plasma.
  • Sequence similaritiesContains 1 IGFBP N-terminal domain.
    Contains 1 thyroglobulin type-1 domain.
  • Developmental stageIGFBP3 levels are higher during extrauterine life and peak during puberty.
  • DomainThe thyroglobulin type-1 domain mediates interaction with HN.
  • Post-translational
    modifications
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localizationSecreted.
  • Information by UniProt

Active human IGFBP3 full length protein images

  • Densitometry of protein isoforms visualised by 2-DE.
    The densitometry scan demonstrates the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification.
    The triangle indicates the theoretical MWt and pI of the protein.

References for Active human IGFBP3 full length protein (ab88368)

ab88368 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88368.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"