Active human IL2 Receptor beta protein fragment (ab84068)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: AVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWP DRRRWNQ TCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREG VRWRVMAI QDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYF ERHLEFEART LSPGHTWEEAPLLTLKQKQEWICLETLTPDTQYEFQVR VKPLQGEFTTW SPWSQPLAFRTKPAALGIPKVDKKVEPKSCDKTHTCP PCPAPELLGGPS VFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKF NWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKV SNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKG FYPSDIAVEWESNG QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQ GNVFSCSVMHEALH NHYTQKSLSLSPGK
    • Amino acids27 to 237

Specifications

Our Abpromise guarantee covers the use of ab84068 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityab84068 bound to protein A sepharose beads is able to pull down its ligand, IL2.
  • Applications

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Additional Notesab84068 bound to protein A sepharose beads is able to pull down its ligand, IL2.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD122
    • CD122 antigen
    • High affinity IL 2 receptor beta subunit
    • High affinity IL 2 receptor subunit beta
    • High affinity IL-2 receptor subunit beta
    • IL-2 receptor subunit beta
    • IL-2R subunit beta
    • IL-2RB
    • IL15RB
    • IL2 receptor
    • IL2RB
    • IL2RB_HUMAN
    • Interleukin 2 receptor beta
    • Interleukin-2 receptor subunit beta
    • P70 75
    • P70-75
    • P7075
    • p75
    see all
  • FunctionReceptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2.
  • Sequence similaritiesBelongs to the type I cytokine receptor family. Type 4 subfamily.
    Contains 1 fibronectin type-III domain.
  • DomainThe WSXWS motif appears to be necessary for proper protein folding and thereby efficient intracellular transport and cell-surface receptor binding.
    The box 1 motif is required for JAK interaction and/or activation.
  • Cellular localizationMembrane.
  • Target information above from: UniProt accession P14784 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

References for Active human IL2 Receptor beta protein fragment (ab84068)

ab84068 has not yet been referenced specifically in any publications.

Product Wall

The ab25227 antibody specificity on the datasheet shows the products does not block the receptor so it means the receptor is fully functional.The epitope of this antibody has not been determined so I am sorry we are unable to confirm which part of doma...

Read More

Thank you for contacting us.

We cuurrently do not have this product in an albumin free state. The albumin is added by the originating lab as stabilizer and lyophilised prior to shipping. I am sorry for any inconvenience this may cause. Read More

This purifed IL-2beta receptor protein does bind IL-2 as shown by its ability to precipitate it whenab84068 is bound to protein A beads in an immunoprecipitation experiment. However it is not a fully functional receptor as ab84068 only contains the ext...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"