Active human p75 NGF Receptor protein fragment (ab83678)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical sequence: KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPC LDSVTFSDVVSATEPCKPCTE CVGLQSMSAPCVEADDAVCRCAYGYYQ DETTGRCEACRVCEAGSGLVFSCQDKQNTVC EECPDGTYSDEANHVDP CLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSD STAPS TQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNGSSNTKVDKKV EPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids0 to 0

Specifications

Our Abpromise guarantee covers the use of ab83678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThe ED50 of this chimera is typically 0.7 - 1.0 ug/ml as measured by its ability to neutralize beta NGF mediated proliferation of the human growth factor dependent TF-1 cell line.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % by SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General info

  • Alternative names
    • CD271
    • CD271 antigen
    • Gp80 LNGFR
    • Gp80-LNGFR
    • Low affinity nerve growth factor receptor
    • Low affinity neurotrophin receptor p75NTR
    • Low affinity neurotrophin receptor p75NTR
    • Low-affinity nerve growth factor receptor
    • Nerve growth factor receptor
    • Nerve growth factor receptor TNFR superfamily member 16
    • NGF receptor
    • NGF receptor
    • NGFR
    • p75 ICD
    • p75 ICD
    • p75 Neurotrophin receptor
    • p75 NTR
    • p75(NTR)
    • p75NTR
    • TNFR Superfamily Member 16
    • TNFRSF16
    • TNR16_HUMAN
    • Tumor necrosis factor receptor superfamily member 16
    see all
  • FunctionLow affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.
  • Sequence similaritiesContains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • DomainDeath domain is responsible for interaction with RANBP9.
    The extracellular domain is responsible for interaction with NTRK1.
  • Post-translational
    modifications
    N- and O-glycosylated.
    O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
    Phosphorylated on serine residues.
  • Cellular localizationMembrane.
  • Information by UniProt

References for Active human p75 NGF Receptor protein fragment (ab83678)

ab83678 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us and your interest in our products. I am sorry for the delay in getting back to you.
Currently, only the p75 NGF Receptor protein ab83678 has been shown to have biological activity. This has been performed by measuring t...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"